... Air pollution induced changes in pine needle chemistry were observed at sample sites in the surroundings of the Pechenganikel smelter. ... Close to the pollution source needles were enriched in Ni and Cu by needle age. Correlation and principal component analyses show that changes in the element composition of pine needles depended on air pollution and on natural factors as well. The contribution from air pollution increased with needle age. ...

Еще в разделе: (Показать все результаты (>26) - eco.soil.msu.ru/ )

. The work is supported by the Russian Foundation for Basic Research, grant 10-07-00685-a . PDB . Classification . Domain instances . Bonded with NA . 1BMV . VIRUS/RNA . 1 . 0 . 1PGL . VIRUS/RNA . 1 . 1 . total (2 entries) . 2 . 1 . No comments on this family . Send your questions and comments to sas@belozersky.msu.ru .

Еще в разделе: (Показать все результаты (>157) - monkey.belozersky.msu.ru/ )

• SCOP classification

День Физика . ... Новости . ... Абитуриентам . ... Главная Новости Наука . ... Новости сайта . ...

Еще в разделе: (Показать все результаты (>6) - www.dubinushka.ru/ )

. Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . Тема обращения: . Описание проблемы: . Введите почтовый адрес: . Войти в систему . Регистрация . Главная . Поиск . Статистика . О проекте . Помощь . Издательство: Institute of Electrical and Electronics Engineers . Местоположение издательства: United States . ї 2011-2015 НИИ механики МГУ . Лаборатория 404. Все права защищены.

Еще в разделе: (Показать все результаты (>1361) - istina.msu.ru/ )

• Shutov I.V. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Takahashi M. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Kosugi T. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

... Large potentials of small heat shock proteins. ... HSPB1 directly or indirectly participates in the regulation of apoptosis, protects the cell against oxidative stress, and is involved in the regulation of the cytoskeleton. ... All small heat shock proteins play important "housekeeping" roles and regulate many vital processes; therefore, they are considered as attractive therapeutic targets. ...

Еще в разделе: (Показать все результаты (>32) - biochem.bio.msu.ru/ )

• Biochemistry Department of Moscow State University | Education

POSTER SESSIONS . ... The sessions will be held in the Entrance Hall and in the foyer of the 2nd floor of the Faculty of Physics MSU from 15:30 to 17:30 on both Wednesday 21 August, 2002 and Friday 23 August, 2002. ... For each poster presentation, a 1.5 meter x 1.5 meter board is provided by the ISNA-16 Organizers. ... On this board, the authors place graphs, diagrams, data, pictures, and a small amount of text to illustrate the main points of their presentation. ...

Еще в разделе: (Показать все результаты (>74) - acs366.phys.msu.su/ )

• Schedule : Nonlinear Acoustics and Flows, Instabilities, Turbulence, and
• Abstract

... The role of wine tax-farming system in the forming of large capitals in Russia in the 19th century, . ... The article is devoted to one of the most profitable business activities in Russia at the end of the 18th century to the beginning of the 1860s. The author researches the social and national structure of wine tax-farmers, the level of their incomes as well as the ways and methods of accumulation of capital, in particular, their ties with the aristocracy and state officials of all levels. ...

Еще в разделе: (Показать все результаты (>117) - hist.msu.ru/ )

• Work incentives: Yaroslavl workshop program

... Поступление в лабораторию . ... Электронный журнал "Компьютерная графика и мультимедиа" . Учебные курсы лаборатории . ... Large-lexicon attribute-consistent text recognition in natural images . ...

Еще в разделе: (Показать все результаты (>122) - graphics.cs.msu.ru/ )

• A system for large-scale automatic traffic sign recognition and mapping |

The Ecological Cooperation Project is the first large-scale children's network project in Russia. This project was founded on the principles of development and achievement of widespread nature awareness among Russian school children through the establishment and unification of numerous childrenтАЩs ecological projects. ... Nature Protected Areas . ... The Project is open for cooperative learning, and any childrenтАЩs ecological organization or group is welcome to participate. ...

Еще в разделе: (Показать все результаты (>5) - www.ecocoop.ru/ )

You may see figures of this paper below... or download the whole paper in PostScript or LaTeX source , everything compressed by ZIP. LaTeX notes: you would need some specific LaTeX styles . See CS-11 HomePage for more. Figures are in EPS (Encapsulated PostScript) format to be inserted using software like dvips . You can download these files via ftp. If you use GIF format, choose "Save Image As..." on the images below, or click here: first and second . Figure 1. ...

Еще в разделе: (Показать все результаты (>27) - uranus.sai.msu.ru/ )

. General Information . Media Files . Participants . Timetable . Local Information . Photos . Back to the album list . Previous Click the image to view it in fullsize. Previous . The BTA (Bolshoi Teleskop Alt-azimutalnyi, Eng:Large Altazimuth Telescope) is a large 6 m optical telescope at the Special Astrophysical Observatory. The BTA-6 was the largest telescope in the world between its first light in 1975 and 1993.

Еще в разделе: (Показать все результаты (>189) - site2010.sai.msu.ru/ )

• General information

sp|P0C6L4|LHDAG_HDV83 Large delta antigen ; MSQSETRRGRRGTREETLEKWITARKKAEELEKDLRKTRKTIKKLEEENPWLGNIVGIIR KGKDGEGAPPAKRPRTDQMEVDSGPGKRPHKSGFTDKEREDHRRRKALENKKKQLSAGGK ILSKEEEEELRRLTDEDEERKRRVAGPRVGDVNPSRGGPRGAPGGGFVPQMAGVPESPFS RTGEGLDIRGTQGFPWVSPSPPQQRLPLLECTPQ sp|P0C6L5|LHDAG_HDVAM Large delta ...

Еще в разделе: (Показать все результаты (>441) - kodomo.cmm.msu.ru/ )

• http://kodomo.fbb.msu.ru/~alex2308/align/delta.fasta
• http://kodomo.cmm.msu.ru/~golikov_v/practices/delta.fasta
• http://kodomo.cmm.msu.ru/~is_rusinov/projects/Alignment/deltaH.fasta

BULLETIN No.1 . ... XX International Workshop . on High Energy Physics and Quantum Field Theory . ... September 24 - October 1, 2011 . Organizers: D.V. Skobeltsyn Institute of Nuclear Physics, . M.V. Lomonosov Moscow State University and . Faculty of Physics, Southern Federal University . INFORMATION BULLETIN No.1 . ... Advisory Committee . ... Talks will be selected by the Organizing Committee on the basis of abstracts to be submitted before May the 1st, 2011. ...

Еще в разделе: (Показать все результаты (>215) - qfthep.sinp.msu.ru/ )

• Bulletins
• QFTHEP'2015 Proceedings
• June 26, 2015

Igor P. Lokhtin . Participation in Conferences, Workshops and Schools in High Energy Physics . ... 18th Annual RDMS CMS Collaboration Conference . ... The 15th International Conference on Strangeness in Quark Matter . ... XXII International Workshop on High Energy Physics and Quantum Field Theory . ... International Conference-Session of the Section of Nuclear Physics of the Physical Sciences Division of Russian Academy of Sciences "Physics of Fundamental Interactions" . ... 4 March, 2011 (CERN) . ...

Еще в разделе: (Показать все результаты (>56) - lav01.sinp.msu.ru/ )

• Etapi- Comments 3/1/97

... 07.04.2016 (Thursday) Session 1 10:00-10:20 10:20-10:40 10:40-11:00 11:00-11:20 11:20-11:40 ­ ­ ­ ­ ­ (chairman ­ M. Stynes) N. Kopteva V. Andreev H.-G. Roos S. Franz, H.-G. Roos A posteriori error estimates for singularly perturbed reactiondiffusion problems on anisotropic meshes. ... Numerical solution of a singularly perturbed initial-boundary value problem with a Neumann condition for a parabolic equation. ... Boundary layer solutions to time-periodic singularly perturbed parabolic problems. ...

Еще в разделе: (Показать все результаты (>9) - math.phys.msu.ru/ )

First Session : a general experimental and theoretical framework (Chair: A. Masiero) . Dark Matter: the experimental quest in the laboratory (C. RUBBIA) . LHC impact on Dark Matter searches (D. CERDENO) . ... Second Session : review of running Dark Matter experiments at LNGS and their future perspectives (Chair: E. COCCIA) . ... Fourth Session : review on the status and perspectives of Dark Matter searches carried out around the world and review of new proposals at LNGS (Chair: R. CASHMORE) . ...

Еще в разделе: (Показать все результаты (>145) - nuclphys.sinp.msu.ru/ )

• Новая страница 1

... 2) Place of the conference has been changed from the lecture hall V-3 to the lecture hall V-2 in the First Academic Building of MSU on New Territories (it is marked on the map of MSU campus on the web-site). ... 6) For participants from abroad Russia here is additional information about the money exchange - we would recommend you to bring at least 300-400 euro with you in cash because of the following considerations: . ... for one dinner in the evening you should calculate not less than 15-20 euro ....

Еще в разделе: (Показать все результаты (>105) - polly.phys.msu.ru/ )

• Seminar in Polymer Physics
• SHORT ANNOTATION AND MAIN RESULT

... Company Presentation, Workshops & Evening Reception Wednesday 30th September 2009, 14:30 - 19:30 Sheraton Palace Hotel Moscow, Rooms St.Petersburg 1-2 The presentation will give you an insight in our business model, our culture. Workshops will provide you with information on how to apply for full-time positions and internships. ... To register for the event, please apply online at www.barcap.com/expectexcellence and select "Moscow" as the location in your application. ...

Еще в разделе: (Показать все результаты (>55) - www.msu.ru/ )

.

Еще в разделе: (Показать все результаты (>68) - comet.sai.msu.ru/ )

• Previous and Proposed
• The IMG (Image) Element
• Network domains and mail addresses

pssh: pssh (tools for collective remote system management) pssh: pssh: Pssh, a.k.a. "parallel ssh", are Python-written wrapper scripts for pssh: OpenSSH and rsync tools. ... Included pssh: are parallel versions of ssh, scp, and rsync, as well as a parallel pssh: kill command. pssh: pssh: Pssh has been written by Brent Chun <bnc at theether.org>, and is pssh: currently maintained by Andrew McNabb <amcnabb at mcnabbs.org>. pssh: Homepage: http://parallel-ssh.googlecode.com ...

Еще в разделе: (Показать все результаты (>12886) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/internet-drafts/draft-levine-smtp-compress-00.txt
• http://mirror.msu.net/pub/slackware-current/slackware/a/xfsprogs-4.3.0-i586-1.txt
• http://mirror.msu.net/pub/slackware-current/slackware/a/lrzip-0.621-i586-1.txt