Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Войти в систему . ... Liu D.Q. , Nosovskiy G.V. , Sourina O. в журнале Pattern Recognition Letters , издательство Elsevier BV (Netherlands) , том 29, ? ...

Еще в разделе: (Показать все результаты (>1388) - istina.msu.ru/ )

• Pattern Recognition - журнал | ИСТИНА - Интеллектуальная Система Тематического
• Pattern Recognition and Image Analysis - журнал | ИСТИНА - Интеллектуальная
• IEEE Transactions on Pattern Analysis and Machine Intelligence - журнал |

Электронная библиотека Попечительского совета . ... Friedman M., Kandel A. - Introduction to pattern recognition . ... Название: Introduction to pattern recognition . Авторы: Friedman M., Kandel A. Аннотация: . This book is an introduction to pattern recognition, meant for undergraduate and graduate students in computer science and related fields in science and technology. ... Pattern recognition system 2 . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>4804) - lib.mexmat.ru/ )

• Meisel W.S. - Computer-oriented approach to pattern recognition :: Электронная
• Boffi G., Buchsbaum D. - Threading Homology through Algebra: Selected Patterns
• Evitts P. - A UML Pattern Language :: Электронная библиотека попечительского

PHP Manual . ... PHP 3 <= 3.0.18, PHP 4 >= 4.0.0) split -- split string into array by regular expression . array split ( string pattern, string string [, int limit]) . Note: preg_split() , which uses a Perl-compatible regular expression syntax, is often a faster alternative to split() . Returns an array of strings, each of which is a substring of string formed by splitting it on boundaries formed by the regular expression pattern . ... Please note that pattern is a regular expression. ...

Еще в разделе: (Показать все результаты (>71) - oit.cmc.msu.ru/ )

• preg_split
• Pattern Modifiers
• pdf_begin_pattern

... Plain examples: path:foo/bar a name bar in a directory named foo in the root of the repository path:path:name a file or directory named "path:name" Glob examples: glob:*.c any name ending in ".c" in the current directory *.c any name ending in ".c" in the current directory **.c any name ending in ".c" in any subdirectory of the current directory including itself. foo/*.c any name ending in ".c" in the directory foo foo/**.c any name ending in ".c" in any subdirectory of foo including itself. ...

Еще в разделе: (Показать все результаты (>876) - kodomo.cmm.msu.ru/ )

• Patterns Prosites
• Help 10(patterns)/term2/2007
• Pattern 3

... Plain examples: path:foo/bar a name bar in a directory named foo in the root of the repository path:path:name a file or directory named "path:name" Glob examples: glob:*.c any name ending in ".c" in the current directory *.c any name ending in ".c" in the current directory **.c any name ending in ".c" in any subdirectory of the current directory including itself. foo/*.c any name ending in ".c" in the directory foo foo/**.c any name ending in ".c" in any subdirectory of foo including itself. ...

Еще в разделе: (Показать все результаты (>3477) - kodomo.fbb.msu.ru/ )

• Help 10 (patterns)
• Task 10 (patterns), 2010
• Task9 (patterns), 2009

... Video tracking and behavior segmentation of laboratory rodents. Pattern Recognition and Image Analysis . ...

Еще в разделе: (Показать все результаты (>102) - graphics.cs.msu.ru/ )

• High-Quality Algorithm for Bayer Pattern Interpolation | Graphics and Media Lab
• High-Quality Algorithm for Bayer Pattern Interpolation | Лаборатория
• Recommendations for taking calibration photos | Graphics and Media Lab

... Screening pattern or alignment against protein databank . ... Protein databanks . SWISSPROT protein databank PDB: Biopolymer 3D structures . ... Pattern Alignment . ... Pattern (or alignment) . Pattern example 1: . ... Alignment example: . FA9_CAVPO GPHVTEVEGTNFLTGIISWGEE-CAMKGKYGIYTKVSRYVNW- FA9_PIG GPHVTEVEGTSFLTGIISWGEE-CAVKGKYGIYTKVSRYVNW- KAG_PIG GPLICNGM----WQGITSWGhtpCGSANKPSIYTKLIFYLDWI FA9_CAVPO FCAGFHEGGRDSCQGDSG FA9_PIG FCAGFHEGGKDSCLGDSG KAG_PIG LCAGYLPGGKDTCMGDSG . ...

Еще в разделе: (Показать все результаты (>121) - www.genebee.msu.ru/ )

• Screening of pattern or alignment against PROTEIN databank

... Application of the three-dimensional RapoportтАУLeas equation to problems of hydrocarbon secondary migration" . Zhuravlev A.S., Zhuravlev E.S., Shabarov A.B. The problem of modeling the processes of migration and accumulation of hydrocarbons in geological reservoirs is considered. ... Keywords: secondary migration of hydrocarbons, three-dimensional Rapoport-Leas equation, counter-current capillary-gravitational impregnation, finite-difference methods, splitting of numerical schemes . ...

Еще в разделе: (Показать все результаты (>148) - num-meth.srcc.msu.ru/ )

• "Mathematical simulation of creep processes in metal patterns made of materials
• Application of the boundary integral equation method to numerical solution of
• On the numerical solution of the Neumann boundary value problem for the

Astronomy Picture of the Day . ... 29.04.2008 . ... Hundreds of thousands of airplane flights take place over the US every day. ... The movie depicts flight patterns that occurred over a few days in 2005 March. The count on the lower left shows the number of flights USA-related flights at the time listed on the lower right. ... Inspection of the movie shows that some times of the day are busier than others, indicating that flights leave some destinations at times that are convenient for travelers. ...

Еще в разделе: (Показать все результаты (>2603) - www.astronet.ru/ )

• Астронет > Airplane Flight Patterns over the USA
• Cancri 55 e: Climate Patterns on a Lava World
• Астронет > Cancri 55 e: Climate Patterns on a Lava World

... 2008 April 29 . Airplane Flight Patterns over the USA . ... Millions of people move about planet Earth by airplane every day. Hundreds of thousands of airplane flights take place over the US every day. ... The movie depicts flight patterns that occurred over a few days in 2005 March. ... Inspection of the movie shows that some times of the day are busier than others, indicating that flights leave some destinations at times that are convenient for travelers. ... About APOD | ...

Еще в разделе: (Показать все результаты (>894) - www.sai.msu.su/ )

• Creating a tileable pattern (00)
• CGFA- Joseph Peacock: The Pattern at Glendalough, Co. Wicklow
• Psql support

Б.П. Леонтьев . ... The very first problem is to select American Educational Materials (AEM), which are of high quality and wide nomenclature. ... Analysis undertaken in [ 1,3 ] revealed time patterns in this process. Time milestones are given to work out original educational and research products, which are based on redesign of AEM and on intercultural experience acquired during participation in JFDP. ...

Еще в разделе: (Показать все результаты (>67) - www.prof.msu.ru/ )

. [ Войти ] . Главная -> Фильмы -> Patterns . Пользователи . Демо . Деньги . Фильмы . Форум . Patterns . США 1956 . отметить . Драма . Fielder Cook . Van Heflin . Everett Sloane . Ed Begley . Beatrice Straight . Elizabeth Wilson . Joanna Roos . Valerie Cossart . Eleni Kiamos . Ronnie Welsh . Shirley Standlee . Andrew Duggan . Jack Livesy . John Seymour . James Kelly . John Shelly . Victor Harrison . Sally Gracie . Sally Chamberlin . Ed Binns . Michael Dreyfuss . Elaine Kaye . Adrienne Moore .

Еще в разделе: (Показать все результаты (>207) - kinfo.ru/ )

• Patterns [1956] - Фильм - Фильмы - Kinfo.ru
• Erotic Boundaries - Фильмы - Kinfo.ru
• Boundaries - Фильмы - Kinfo.ru

. This diagram illustrates how a background image may be repeated within the content and padding areas of a box. In this example, a background image is first centered within a box (established by the BODY element of the example). The box contains paragraphs of text, shown in gray to make them discrete. The image, a blue wavy line on a pale yellow background, is then repeated vertically, to the top and bottom of the BODY box. The effect is to create a wavy band down the center of the page. Return to image.

Еще в разделе: (Показать все результаты (>3780) - crydee.sai.msu.ru/ )

• Unsteady boundary layer transition
• Manipulated Boundary Layer
• Boundary layer transition

Myotis . Uropatagium venation pattern in bats as diagnostic character (by the example of genus Myotis ) . ... By the example of genus Myotis it was shown that venation pattern on uropatagium of bats in some cases can be used as diagnostic character. Venation features on uropatagium allow easy to separate Daubentonв?Ts bat, eastern water bat, big-footed bat, and pond bat from Brandtв?Ts bat, Siberian bat, whiskered bat, and Ikonnikovв?Ts bat. ... Bats]. ... Bats of the Russian Far East]. ...

Еще в разделе: (Показать все результаты (>1216) - zmmu.msu.ru/ )

• Cranial and skeletal growth patterns in red foxes (Vulpes vulpes L., 1758)
• Geographical pattern and historical demography of Midday gerbil Meriones
• Understanding the boundaries between chromosome races of common shrews in terms

... We consider now change-points in different components of the frequency spectrum of typical EEG signal. ... Only few change-points in power are found in the initial EEG (unless a prominent alpha rhythm is present). ... Change-points in different frequency components of the EEG . ... Change-points in different types of the EEG alpha activity without substantial gradual changes . ... As can be seen from Fig. 7.3, the program reliably detected the change-points despite of such variety of signal patterns...

Еще в разделе: (Показать все результаты (>46) - brain.bio.msu.ru/ )

The QRegExp class provides pattern matching using regular expressions and wildcards. ... QRegExp  ( const char *, bool caseSensitive=TRUE, bool wildcard=FALSE )  . ... QRegExp&  operator=  ( const char * pattern )  . bool  operator==  ( const QRegExp & ) const . ... bool  wildcard  () const . ... QRegExp knows these regexp primitives: . ... Returns TRUE if this regexp is equal to r. Two regexp objects are equal if they have equal pattern strings, case sensitivity options and wildcard options. ...

Еще в разделе: (Показать все результаты (>115) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - QBrush Class

... Lateral ramp, of normal fault . ... Lava . ... Lava, structures associated with . ... Line . ... Linear crystal defects, See also Dislocations . ... Linear structures . Linear structures, angle between . Linear structures, deformation of . Linear structures, direction significance of . Linear structures, initial orientation of . Linear structures, plotting methods . ... Lineation . ... Lineation, mineral . Lineation, mineral cluster . ... Listric fan . ... Lithosphere . ...

Еще в разделе: (Показать все результаты (>1053) - geo.web.ru/ )

• Trusov Sergey's homepage The influence of boundary layer effects on the melt
• Dictionary_D
• The influence of boundary layer effects on the melt inclusions compositions.

PATTERNS IN BIOPOLYMERS AND OTHER BIOLOGICAL SYSTEMS AS OBSERVED BY ATOMIC FORCE MICROSCOPY . ... Joint SPM Group, . ... A review of recent results concerning biological, microbiological and medical applications of scanning probe microscopy obtained in Joint SPM Group is presented. Special attention is paid to high resolution vizualization of nucleic acids, proteins , bacterial and animal cells. Emphasis is done on the in situ observation of dynamical changes in biological systems. ...

Еще в разделе: (Показать все результаты (>21) - www.spm.genebee.msu.ru/ )

. Cluster analysis for pattern recognition in solar butterfly diagrams, AN, {\bf 332}, N 6, 590 - 596, 2011 (E.Illarionov, D.Sokoloff, R.Arlt, A.Khlystova). Предложен и реализован на компьютере алгоритм выделения Ветвей баттерфляй-диаграмм. Ключевые слова: Цикл солнечной активности

Еще в разделе: (Показать все результаты (>63) - srcc.msu.ru/ )

• A.V. Setukha. The singular integral equation method in a 3-d boundary problems
• Митрохин С. И. Spectral Properties of Boundary Value Problems for

... Investment", "Deposit", "Universal": West-European Banking Patterns in Russian History, 1864-1917, . ... This paper asserts a new resolution to the old puzzle of Russian banking history: how to explain the dichotomy of deposit and investment commercial banks in Russia. The author arrives at the conclusion that there were two types of competitive banking institutions. Deposit banks served regional business networks by discounting exchange bills. ...

Еще в разделе: (Показать все результаты (>131) - hist.msu.ru/ )

• Visual Images of Patriarch Nikon
• Программа сессии в Будапеште"
• "Novaya i noveishaia istoria" Journal