Astronet Поиск по астрономическим сайтам English Russian
       
        Точная форма слов   О проекте   Сайты   Справка
Поиск по:monkey.belozersky.msu.ru/    - Поискать по всем серверам
Найдено документов: 2880 ---- Время поиска: 1.95сек.   
Каталог астрономических ресурсов

  • Наблюдения, инструменты и базы данных
  • Астрометрия и служба времени
  • Небесная механика и гравиметрия
  • Теоретическая астрофизика
  • Солнечная система
  • Звезды
  • Галактики, квазары, космология
  • Исследование космоса
  • Общие вопросы
  • Прочее

  • 1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | След.

    1. http://monkey.belozersky.msu.ru/npidb/pdb/pdb_new/Block_3D/PF02081.10.blocks.json
    ... 1gtn.pdb1.pdb:A:0:7:74", "1utf.pdb2.pdb:R:0:205:274", "1gtf.pdb2.pdb:O:0:5:74", "1gtf.pdb2.pdb:Q:0:5:74", "1utv.pdb2.pdb:M:0:5:75", "1gtf.pdb1.pdb:G:0:6:75", "1utd.pdb1.pdb:C:0:5:74", "1utd.pdb2.pdb:R:0:5:75", "1utv.pdb2.pdb:R:0:5:74", "1gtf.pdb1.pdb:B:0 ...
    [ Сохраненная копия ]  Ссылки http://monkey.belozersky.msu.ru/npidb/pdb/pdb_new/Block_3D/PF02081.10.blocks.json -- 4.4 Кб -- 04.02.2013
    Похожие документы

    2. http://monkey.belozersky.msu.ru/npidb/pdb/pdb_new/Block_3D/PF10416.4.blocks.json
    ... end": 14, "IDs": ["1pp7.pdb1.pdb:U:0:6:112", "1pp8.pdb1.pdb:F:0:5:112", "1pp8.pdb4.pdb:P:0:5:112", "1pp8.pdb2.pdb:M:0:5:112", "1pp8.pdb3.pdb:U:0:5:112"], "cores": []}, {"start": 19, "end": 27, "IDs": ["1pp7.pdb1.pdb:U:0:6:112", "1pp8.pdb1.pdb:F:0:5:112 ...
    [ Сохраненная копия ]  Ссылки http://monkey.belozersky.msu.ru/npidb/pdb/pdb_new/Block_3D/PF10416.4.blocks.json -- 1.8 Кб -- 04.02.2013
    Похожие документы

    3. http://monkey.belozersky.msu.ru/npidb/pdb/pdb_new/Block_3D/PF10416.4.fasta.hb
    ... 0:5:112 0|file:/data/npidb/pdb/pdb_new/biounits/1pp8.pdb4.pdb:P:0:5:112 0|file:/data/npidb/pdb/pdb_new/biounits/1pp8.pdb2.pdb:M:0:5:112 0|file:/data/npidb/pdb/pdb_new/biounits/1pp8.pdb3.pdb:U:0:5:112 1|file:/data/npidb/pdb/pdb_new/biounits/1pp7.pdb1.pdb:U ...
    [ Сохраненная копия ]  Ссылки http://monkey.belozersky.msu.ru/npidb/pdb/pdb_new/Block_3D/PF10416.4.fasta.hb -- 2.6 Кб -- 09.01.2013
    Похожие документы

    4. http://monkey.belozersky.msu.ru/npidb/pdb/pdb_new/Block_3D/PF05733.6.blocks.json
    ... 4h5o.pdb1.pdb:G:0:3:223", "4h6f.pdb3.pdb:O:0:5:223", "4h5o.pdb2.pdb:I:0:3:223", "4h5o.pdb2.pdb:C:0:3:223", "4h6g.pdb3.pdb:M:0:5:223", "4h5o.pdb1.pdb:A:0:4:223", "4h6f.pdb3.pdb:P:0:5:223", "4h6g.pdb3.pdb:R:0:5:223", "4h6f.pdb1.pdb:B:0:5:223", "4h6g.pdb3 ...
    [ Сохраненная копия ]  Ссылки http://monkey.belozersky.msu.ru/npidb/pdb/pdb_new/Block_3D/PF05733.6.blocks.json -- 3.9 Кб -- 04.02.2013
    Похожие документы

    5. http://monkey.belozersky.msu.ru/npidb/pdb/pdb_new/Block_3D/PF00505.14.blocks.json
    ... 3f27.pdb3.pdb:D:0:68:136", "1e7j.MDL1.pdb:A:0:5:71", "4euw.pdb1.pdb:A:0:105:173", "3tq6.pdb1.pdb:A:0:50:118", "3nm9.pdb1.pdb:M:0:5:71", "3nm9.pdb1.pdb:P:0:5:71", "2lef.MDL1.pdb:A:0:3:71", "pdb1j47.pdb:A:0:5:73", "3tmm.pdb1.pdb:A:0:8:76", "1qrv.pdb1.pdb:A ...
    [ Сохраненная копия ]  Ссылки http://monkey.belozersky.msu.ru/npidb/pdb/pdb_new/Block_3D/PF00505.14.blocks.json -- 2.4 Кб -- 04.02.2013
    Похожие документы

    6. http://monkey.belozersky.msu.ru/npidb/pdb/pdb_new/Block_3D/PF02081.10.fasta.hb
    ... O:0:5:74 0|file:/data/npidb/pdb/pdb_new/biounits/1gtf.pdb2.pdb:Q:0:5:74 0|file:/data/npidb/pdb/pdb_new/biounits/1utv.pdb2.pdb:M:0:5:75 0|file:/data/npidb/pdb/pdb_new/biounits/1gtf.pdb1.pdb:G:0:6:75 0|file:/data/npidb/pdb/pdb_new/biounits/1utd.pdb1.pdb:C:0 ...
    [ Сохраненная копия ]  Ссылки http://monkey.belozersky.msu.ru/npidb/pdb/pdb_new/Block_3D/PF02081.10.fasta.hb -- 9.2 Кб -- 09.01.2013
    Похожие документы

    7. http://monkey.belozersky.msu.ru/npidb/pdb/pdb_new/Block_3D/PF00505.14.fasta.hb
    ... 0:105:173 0|file:/data/npidb/pdb/pdb_new/biounits/3tq6.pdb1.pdb:A:0:50:118 0|file:/data/npidb/pdb/pdb_new/biounits/3nm9.pdb1.pdb:M:0:5:71 0|file:/data/npidb/pdb/pdb_new/biounits/3nm9.pdb1.pdb:P:0:5:71 0|file:/data/npidb/pdb/pdb_new/models/2lef.MDL1.pdb:A ...
    [ Сохраненная копия ]  Ссылки http://monkey.belozersky.msu.ru/npidb/pdb/pdb_new/Block_3D/PF00505.14.fasta.hb -- 4.2 Кб -- 09.01.2013
    Похожие документы

    8. http://monkey.belozersky.msu.ru/npidb/pdb/pdb_new/stride/1u3e.std.txt
    ... 1U3E LOC 310Helix SER 85 M ASN 87 M 1U3E LOC Strand TRP 3 M ASP 5 M 1U3E LOC Strand TYR 13 M SER 16 M 1U3E LOC Strand GLU 20 M ...
    [ Сохраненная копия ]  Ссылки http://monkey.belozersky.msu.ru/npidb/pdb/pdb_new/stride/1u3e.std.txt -- 23.0 Кб -- 04.10.2012
    Похожие документы

    9. http://monkey.belozersky.msu.ru/npidb/pdb/pdb_new/Block_3D/PF00505.14.dict.json
    ... 3tq6.pdb1.pdb:A:0:50:118": "PKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFK", "3nm9.pdb1.pdb:M:0:5:71": "PKRPLSAYALWLNSARESIKRENPGIKVTEVAKRGGELWRAM--KDKSEWEAKAAKAKDDYDRAVKEFE", "3nm9.pdb1.pdb:P:0:5:71 ...
    [ Сохраненная копия ]  Ссылки http://monkey.belozersky.msu.ru/npidb/pdb/pdb_new/Block_3D/PF00505.14.dict.json -- 3.5 Кб -- 04.02.2013
    Похожие документы

    10. http://monkey.belozersky.msu.ru/npidb/pdb/pdb_new/wlake/d.285.1.1.flat.txt
    ... 0 1 377: 2 "BC" 3 1t2t A 0 0 2 338: 2 "BC" 3 1i3j A 0 0 1 364: 2 "BC" 4 1t2t A 0 0 2 404: 2 "BC" 4 1i3j A 0 0 1 345: 2 "BC" 5 1u3e M 106 174 3 36: 2 "ABC" 5 1i3j A 0 0 1 342: 2 "BC" 6 1t2t A 0 0 2 304: 2 "BC" 6 1i3j A 0 0 1 322: 2 "BC" 7 1t2t A 0 0 2 434 ...
    [ Сохраненная копия ]  Ссылки http://monkey.belozersky.msu.ru/npidb/pdb/pdb_new/wlake/d.285.1.1.flat.txt -- 1.7 Кб -- 26.10.2012
    Похожие документы

    1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | След.

    Rambler's Top100 RFBR Яндекс цитирования