Astronet Поиск по астрономическим сайтам English Russian
       
        Точная форма слов   О проекте   Сайты   Справка
Найдено документов: 22204 (220 сайтов) ---- Время поиска: 0.40сек.   
Каталог астрономических ресурсов

  • Наблюдения, инструменты и базы данных
  • Астрометрия и служба времени
  • Небесная механика и гравиметрия
  • Теоретическая астрофизика
  • Солнечная система
    		•
  • Звезды
  • Галактики, квазары, космология
  • Исследование космоса
  • Общие вопросы
  • Прочее

    • Пред. | 1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | След.

    31. G189.1+3.0
    ... ADS . White et al. 1987, A&A, 173, 337. Observations of shocked molecular species. ADS . Graham et al. 1987, ApJ, 313, 847. ...
    [ Сохраненная копия ]  Ссылки http://www.mrao.cam.ac.uk/projects/surveys/snrs-1998/snrs.G189.1+3.0.html -- 8.5 Кб -- 10.04.2016
    Похожие документы
    Еще в разделе: (Показать все результаты (>163) - www.mrao.cam.ac.uk/ )

    32. No Title
    ... List of my publications . Panchuk V.E. On the propagation of shock wave through the stellar atmosphere. Sov. ... Panchuk V.E. Some physical properties of the shock-waves in the RR Lyraes stars atmospheres. ...
    [ Сохраненная копия ]  Ссылки http://mavr.sao.ru/hq/ssl/panchuk/publ/publ.html -- 42.0 Кб -- 10.04.2016
    [ Сохраненная копия ]  Ссылки http://www.sao.ru/hq/ssl/panchuk/publ/publ.html -- 42.0 Кб -- 10.04.2016
    [ Сохраненная копия ]  Ссылки http://jet.sao.ru/hq/ssl/panchuk/publ/publ.html -- 42.0 Кб -- 09.04.2016
    Похожие документы
    Еще в разделе: (Показать все результаты (>53) - jet.sao.ru/ )

    33. http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2015/Mareev_Potemkin_en.pdf
    ... On the nanosecond timescale the superposition of the spherical shock waves builds one contrast cylindrical shock wave, and the overlapped cavitation bubbles construct one cylindrical cavitation area on the microsecond timescale, which evolution ...
    [ Текст ]  Ссылки http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2015/Mareev_Potemkin_en.pdf -- 104.7 Кб -- 11.01.2015
    Похожие документы
    Еще в разделе: (Показать все результаты (>6) - ofvp.phys.msu.ru/ )

    34. http://kodomo.cmm.msu.ru/~nrar/Term2/all.fasta
    ... shock protein 33) (HSP33) MPQHDQLHRYLFENFAVRGELVTVSETLQQILENHDYPQPVKNVLAELLVATSLLTATLKFDGDITVQLQ GDGPMNLAVINGNNNQQMRGVARVQGEIPENADLKTLVGNGYVVITITPSEGERYQGVVGLEGDTLAACL EDYFMRSEQLPTRLFIRTGDVDGKPAAGGMLLQVMPAQNAQQDDFDHLATLTETIKTEELLTLPANEVLW ...
    [ Сохраненная копия ]  Ссылки http://kodomo.cmm.msu.ru/~nrar/Term2/all.fasta -- 3.7 Кб -- 02.05.2008
    Похожие документы

    35. Rupes Recta [Архив] - Общая Астрономическая Конференция
    ... blackhaz . 07.06.2006, 15:20 . :shock: . 84x Я сначала подумал - блин! - надо окуляры почистить. ... Присматриваюсь. :mrgreen: Такое ощущение, что кто-то дорогу начал строить на Луне. :-s :shock: Нет, такое не может быть! ...
    [ Сохраненная копия ]  Ссылки http://www.starlab.ru/archive/index.php/t-5708.html -- 11.0 Кб -- 10.04.2016
    Похожие документы

    36. Stellar shock waves shaped our solar system | Astronomy.com
    ... Shop . Home . / . News . / . Stellar shock waves shaped our solar system . ...
    [ Сохраненная копия ]  Ссылки http://www.astronomy.com/News-Observing/News/2012/09/Stellar%20shock%20waves%20shaped%20our%20solar%20system.aspx -- 68.5 Кб -- 10.04.2016
    Похожие документы

    37. http://tunka.sinp.msu.ru/en/presentation/Zirakashvili.pdf
    ... shocks in SNRs · Amplification of magnetic fields · Modeling of broad-band emission ... CD is close to the forward shock ­ evidence of the shock modification by CR pressure ...
    [ Текст ]  Ссылки http://tunka.sinp.msu.ru/en/presentation/Zirakashvili.pdf -- 2158.2 Кб -- 22.05.2011
    Похожие документы

    38. http://ssrt.iszf.irk.ru/html/public2012_ru.html
    ... A.N., Uralov A.M. Coronal Shock Waves, EUV Waves, and Their Relation to CMEs ... Modeling MHD Shock Wave Propagation Along the Solar Surface, Using Nonlinear ... N.S., Kalashnikov S.S., Kubo Y Coronal Shock Waves, EUV Waves, and Their Relation to ...
    [ Сохраненная копия ]  Ссылки http://ssrt.iszf.irk.ru/html/public2012_ru.html -- 10.8 Кб -- 08.04.2016
    Похожие документы
    Еще в разделе: (Показать все результаты (>10) - ssrt.iszf.irk.ru/ )

    39. http://geo.web.ru/conf/khitariada/informbul-1/planet-3.engl.pdf
    ... the shock flat waves generated with the help of mud caps of explosive, or by shock ... shock waves [3] opens out new capabilities of analysis of matter loaded different ...
    [ Текст ]  Ссылки http://geo.web.ru/conf/khitariada/informbul-1/planet-3.engl.pdf -- 142.0 Кб -- 30.12.2002
    Похожие документы

    40. Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika Вестник
    ... of ignition of aviation kerosene by a shock wave / V. L. Kovalev, A. S. Vetchinkin ... of the aviation kerosene surrogate by a shock wave has been investigated ... The shock wave's parameters have been determined and the ignition time dependence on ...
    [ Сохраненная копия ]  Ссылки http://vestnik.math.msu.su/en/DATA/2014/2/node13 -- 6.4 Кб -- 10.04.2016
    Похожие документы

    Пред. | 1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 |