Документ взят из кэша поисковой машины. Адрес оригинального документа : http://mouse.belozersky.msu.ru/npidb/data/pdb_new/hmm/pdb6gat.pdb.hmm.txt Дата изменения: Fri Oct 9 19:11:47 2015 Дата индексирования: Sun Apr 10 21:38:56 2016 Кодировка:

# pfam_scan.pl, run at Fri Oct 9 19:11:46 2015
#
# Copyright (c) 2009 Genome Research Ltd
# Freely distributed under the GNU
# General Public License
#
# Authors: Jaina Mistry (jm14@sanger.ac.uk), John Tate (jt6@sanger.ac.uk),
# Rob Finn (rdf@sanger.ac.uk)
#
# This is free software; you can redistribute it and/or modify it under
# the terms of the GNU General Public License as published by the Free Software
# Foundation; either version 2 of the License, or (at your option) any later version.
# This program is distributed in the hope that it will be useful, but WITHOUT
# ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS
# FOR A PARTICULAR PURPOSE. See the GNU General Public License for more
# details.
#
# You should have received a copy of the GNU General Public License along with
# this program. If not, see .
# = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = =
# query sequence file: /data/npidb/pdb/pdb_new/fasta/pdb6gat.pdb.fas
# searching against: /mnt/databanks/pfamdata/Pfam-A.hmm, with cut off -E 0.001 --domE 0.001
# resolve clan overlaps: on
# predict active sites: off
# = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = =
#
#

6gat_A 12 45 12 46 PF00320.22 GATA Domain 1 35 36 61.4 3.6e-17 1 CL0167
#HMM CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl
#MATCH C+nC t +Tp WRr+p+g++ LCnaCGl+ +++g+
#PP ********************.************97
#SEQ CTNCFTQTTPVWRRNPEGQP-LCNACGLFLKLHGV