Документ взят из кэша поисковой машины. Адрес оригинального документа : http://mouse.belozersky.msu.ru/npidb/data/pdb_new/hmm/3vd6.pdb1.pdb.hmm.txt Дата изменения: Fri May 17 01:50:55 2013 Дата индексирования: Fri Feb 28 22:11:58 2014 Кодировка:

# pfam_scan.pl, run at Fri May 17 01:50:54 2013
#
# Copyright (c) 2009 Genome Research Ltd
# Freely distributed under the GNU
# General Public License
#
# Authors: Jaina Mistry (jm14@sanger.ac.uk), John Tate (jt6@sanger.ac.uk),
# Rob Finn (rdf@sanger.ac.uk)
#
# This is free software; you can redistribute it and/or modify it under
# the terms of the GNU General Public License as published by the Free Software
# Foundation; either version 2 of the License, or (at your option) any later version.
# This program is distributed in the hope that it will be useful, but WITHOUT
# ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS
# FOR A PARTICULAR PURPOSE. See the GNU General Public License for more
# details.
#
# You should have received a copy of the GNU General Public License along with
# this program. If not, see .
# = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = =
# query sequence file: /data/npidb/pdb/pdb_new/fasta/3vd6.pdb1.pdb.fas
# searching against: /mnt/databanks/pfamdata/Pfam-A.hmm, with cut off -E 0.001 --domE 0.001
# resolve clan overlaps: on
# predict active sites: off
# = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = =
#
#

3vd6_C 4 37 4 38 PF00320.22 GATA Domain 1 35 36 57.7 5.1e-16 1 CL0167
#HMM CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl
#MATCH C+nCg+t TplWRr+ g++ LCnaCGly++ +g+
#PP ********************.***********997
#SEQ CVNCGATATPLWRRDRTGHY-LCNACGLYHKMNGQ
3vd6_C 44 77 44 78 PF00320.22 GATA Domain 1 35 36 59.7 1.2e-16 1 CL0167
#HMM CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl
#MATCH C+nC+tt+T+lWRr+ +g + +CnaCGly++++ +
#PP ********************.***********987
#SEQ CTNCQTTTTTLWRRNASGDP-VCNACGLYFKLHQV