Документ взят из кэша поисковой машины. Адрес оригинального документа : http://kodomo.cmm.msu.ru/~ksenia_yashina/projects/gene_en.doc Дата изменения: Sun Dec 21 01:31:16 2008 Дата индексирования: Tue Oct 2 14:47:03 2012 Кодировка:

Description of accB gene from E.coli genome

|Content |Information |
|Short gene name |accB |
|Synonyms (if exist) |none |
|DNA-strand |main |
|Number of the 1st |3403458 |
|nucleotide of coding | |
|sequence | |
|Number of last |3403928 |
|nucleotide of coding | |
|sequence | |
|First codon |ATG |
|Stop-codon |TGA |
|Locus name |b3255 |
|Protein id in UniprotKB |ID=BCCP_ECOLI |
|data base |AC=P0ABD8 |
|Full protein name |acetyl CoA carboxylase, BCCP subunit |
|Extra information |function=carrier; Biosynthesis of cofactors, |
| |carriers: biotin carboxyl carrier protein |
| |(BCCP) |


Aminoacid sequence in fasta format:

>BCCP_ECOLI acetyl CoA carboxylase
MDIRKIKKLIELVEESGISELEISEGEESVRISRAAPAASFPVMQQAYAAPMMQQPAQSNAAAPATVPSMEAPAAA
EISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPL
VVIE