Network Working Group Request for Comments: 2053 Category: Informational E. Der-Danieliantz AM Network Information Center October 1996 The AM (Armenia) Domain Status of this Memo This memo provides information for the Internet community. This memo does not specify an Internet standard of any kind. ... Der-Danieliantz Informational [Page 1] RFC 2053 The AM (Armenia) Domain October 1996 The registration is performed by the AM Network Information Center, national Internet registry of Armenia. ...

Еще в разделе: (Показать все результаты (>14712) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/bcp/bcp171.txt
• http://mirror.msu.net/pub/rfc-editor/internet-drafts/draft-hardjono-oauth-resource-reg-07.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc6441.txt.pdf

Welcome , Registration , and other StartingPoints ; TWiki history & Wiki style; All the docs.. ... TWiki ? ... Listing of CSS class names emitted from TWiki core code and standard plugins, for the Dakar release. ... Most html elements generated by TWiki core code now have Cascading Style Sheet (CSS) tags. Skin builders and others who want to change the appearance of the default TWiki installation or any of the skins can use this document to see what styles can be created for these html elements. ...

Еще в разделе: (Показать все результаты (>48209) - dualopt1.cmm.msu.ru/ )

• ManagingWebs - TWiki - TWiki

... MySQL shareware license for Microsoft operating systems (Version 1, September 4, 1998) . ... This License applies when running MySQL on any Microsoft operating system. Microsoft operating systems include all versions of Microsoft Windows NT and Microsoft Windows. ... E-Mail: mysql-licensing@mysql.com For more about the license prices and commercial support, like email support, please refer to the MySQL manual. ... Our current policy is that a user with the MySQL license can get free upgrades. ...

Еще в разделе: (Показать все результаты (>727) - itpm.msu.su/ )

• mod_status - Apache HTTP Server
• Converting Modules from Apache 1.3 to Apache 2.0 - Apache HTTP Server
• apachectl - Apache HTTP Server Control Interface - Apache HTTP Server

Canada Business Service Centres) - CBSC : 28.05.2004 4046 ­ , , . 2001 Canada Business Service Centre. All rights reserved. Reprinted with permission. Further reproduction prohibited. ... Human Resources Development Canada). ... U.S. Small Business Administration) : « , - ». Saskatchewan Industry and Resources, Business and Co-operative Services). ...

Еще в разделе: (Показать все результаты (>43) - innovation.msu.ru/ )

• http://www.innovation.msu.ru/russian/guidetomarketresearch_rus.pdf
• http://www.innovation.msu.ru/russian/marketingplanoutline_rus.pdf
• http://www.innovation.msu.ru/russian/pointstoconsider_rus.pdf

... III International Conference on Heterocyclic Chemistry, . in Honor of the late Professor A.N. Kost's 95th Anniversary . ... Thank you for registering at the III International Conference "Chemistry of Heterocyclic Compounds"! Your personal details were filled in the conference database, and the login and password were sent to the email address provided at registration. ... If you have any questions, please contact the Technical Secretariat of the Conference: . ...

Еще в разделе: (Показать все результаты (>803) - chem.msu.ru/ )

• Registration Fees. III International Conference on Heterocyclic Chemistry, in
• News. III International Conference on Heterocyclic Chemistry, in Honor of the
• Transfers. III International Conference on Heterocyclic Chemistry, in Honor of

. News . Updates . On the Institute . Status of the Institute . Institute Laboratory-Chairs . Russian Interdisciplinary Temporology Seminar . Library of Electronic Publications . Journals about time . Web resources . Proceedings of the Institute . The International Society for the Study of Time . Hall of the Arts . Site map . Collection of temporology screen savers . Copyright © 2001 . All rights reserved. The International Society for the Study of Time . Website of the Society . KronoScope .

Еще в разделе: (Показать все результаты (>1163) - chronos.msu.ru/ )

• Library of Electronic Publications
• Web resources
• On the Institute

... Conference Venue . ... October 30, 2012 opening of the conference and get together . October 31 - November 1, 2012 conference dates . November 2, 2012 closing of the conference . ... Members of IHSS have a privilege of 15% discount. The registration fee includes participation in the conference activities, welcome party, coffee breaks, conference dinner and meals. ... Please, download it, fill it in, and send to the Conference Secretariat by e-mail ihss@org.chem.msu.ru . ...

Еще в разделе: (Показать все результаты (>175) - mgumus.chem.msu.ru/ )

• MGUMUS -- Third Conference of CIS IHSS on Humic Innovative Technologies Humic
• MGUMUS -- First International Conference on Humics-based Innovative

... The location - country, state . a summary (2-3 lines) of what your server provides . ... new-wwws@tel.etf.hr . ... District of Columbia: www-request@fedix.fie.com . ... As it is maintained by several people, you will need to explore the VT, find your respective country, and post your announcement to the address given there. email: whats-new@ncsa.uiuc.edu You may also want to announce your server to the newsgroup "comp.infosystems.announce", and to the mailing list "net-happenings@is.internic.net". ...

Еще в разделе: (Показать все результаты (>3556) - crydee.sai.msu.ru/ )

... Geography of World Economy . ... Recreational Geography and International Tourism . ... Physical Geography and Landscape Science . ... Password . Forgot your password? ... About Faculty . ... Research laboratories . The Natural Risk Assessment Laboratory . Field stations . ... Research priorities in science . ... Type of field courses . ... International programme in Natural Resource Management and Law offers a unique combination of Natural and Environmental Sciences and Science of Law. ...

Еще в разделе: (Показать все результаты (>110) - eng.geogr.msu.ru/ )

• International cooperation
• International programme in natural resourse management and law
• Renewable Energy Sources

. About the University . Application . FAQ . Electronic Resources . About the Faculty . Departments . Labs and Research Centres . Photo Archive . Please note that English & Russian versions of this site do not coinside . All rights reserved under Russian & International laws. Copyright © 1997-2011 Faculty of History, MSU. No part of this site may be reproduced electronically or otherwise without the prior written permission of the copyright owner.

Еще в разделе: (Показать все результаты (>37744) - hist.msu.ru/ )

... Security is rarely employed. l Advantages of globus_io ­ Ease of use of security, socket options, QoS ­ Easier Win32 portability ­ Very similar to existing BSD socket calls March 25, 2002 Globus ToolkitTM Developer Tutorial : Communication 2 Approach l l Provide familiar socket and file abstractions Provide both synchronous and asynchronous versions of everything ­ Can easily write code that will not block ...

Еще в разделе: (Показать все результаты (>67) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/presentations/GGtut/Dev-08-Information1.pdf
• http://acat02.sinp.msu.ru/accomod.html
• http://acat02.sinp.msu.ru/InfoBull2.txt

... St. Petersburg , 1-3 November, 2001 «POLAR REGIONS OF THE EARTH - GEOLOGY, TECTONICS, RESOURCE SIGNIFICANCE, NATURAL ENVIRONMENT» «EUROPROBE» SYMPOSIUM «PLATE TECTONICS IN ARCHEAN AND EARLY PROTEROZOIC: GEOLOGICAL AND GEOPHYSICAL DATA» POST-CRUISE WORKSHOP «KNIPOVICH-2000» Ministry of Natural Resources of the Russian Federation Ministry of Industry, Science and Technology of the Russian Federation Russian Academy of Sciences All-Russia Research ... Mineral resources II. ...

Еще в разделе: (Показать все результаты (>1346) - geo.web.ru/ )

• http://geo.web.ru/~sgt/meeting/2001/2001_zonen/circ_1-5_eng_spb.doc
• http://geo.web.ru/users/pavel/Publications/1992_1998/ARTEN976.DOC
• Informal geological society

Boat tour and banquet on Moskva River . ... We have reserved a boat which goes by the Moskva River that crosses the city of Moscow. ... The advanced reservation by e-mail will be considered first. ... The ticket price is $25 for full participants (who have paid $250-$300), and $50 for the accompanying persons and those who paid reduced fee. ... Registration fee: full ($250-300), reduced, or student, or "no fee" (for the accompanying person.) ...

Еще в разделе: (Показать все результаты (>119) - acs366.phys.msu.su/ )

Электронная библиотека Попечительского совета . ... Ruest N., Ruest D. - Windows Server 2003 Pocket Administrator . ... Название: Windows Server 2003 Pocket Administrator . Авторы: Ruest N., Ruest D. Аннотация: . ... You'll get details on file, print, application, mail, terminal, streaming media, and remote servers - and much more. ... Год издания: 2003 . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>15658) - lib.mexmat.ru/ )

• Russel Ch., Crawford Sh. - Microsoft Windows 2000 Server Administrator's
• Williams R., Walla M. - The Ultimate Windows Server 2003 System Administrator's
• Kaczmarek S.D. - Microsoft Systems Management Server 2.0 Administrator's

University Satellites and . Space Science Education . ... The purpose of the developed scientific - educational program complex is creation on the Earth on the base of telemetry data of virtual model of microgravitational environment in which experiments are carried out, and virtual motion model of of the space vehicle. ... The developed program complex concerns to the class of the distributed program systems. ... Skobeltsyn Institute of Nuclear Physics, Moscow State University, 2005-2006 . ...

Еще в разделе: (Показать все результаты (>6721) - cosmos.msu.ru/ )

Biological journals . ... Bulletin of Moscow Society of Naturalists. Biological series . ... Krylovia: a Siberian Botanical Journal . ... Algological Electronic Newsletter . ... Herba: a Moscow Botanical Electronic Anthology . ... Electronic Sites of Botany, Plant Biology and Plant Science Journals . ... A fine old herbarium from MW . ... Type collection of Lomonosov Moscow State University Herbarium (MW) . ... Address: 119992, Moscow, Vorobievy Gory, MSU, Biological Faculty, Herbarium. ...

Еще в разделе: (Показать все результаты (>658) - herba.msu.ru/ )

• INTERNATIONAL SYMPOSIUM

МГУ имени М.В.Ломоносова Русская версия . ... Science calendar . ... World Politics . ... Associate professor, Deputy Dean for scientific research, Faculty of World Politics, Candidate of historical science . ... Associate Professor, the Department of Regional Problems of World Politics, Candidate of historical science . ... Naumkin Vitaly V. - Corresponding Member of the Russian Academy of Sciences, Professor, Head of the Department Regional Issues of World Politics, Doctor of historical science . ...

Еще в разделе: (Показать все результаты (>11452) - conf.msu.ru/ )

Международный учебно-научный лазерный центр МГУ им. М.В. Ломоносова . ... О МЛЦ МГУ . ... Международный учебно-научный лазерный центр МГУ (МЛЦ МГУ) был создан в Московском университете в 1989 году. МЛЦ МГУ занимается организацией фундаментальных и прикладных исследований на стыках лазерной физики, нелинейной оптики и других естественных наук, а также обучением и повышением квалификации специалистов. ... Конкурс молодых ученых МГУ . ... Семинар кафедры ОФиВП и МЛЦ . 8 апереля 2016 . ...

Еще в разделе: (Показать все результаты (>807) - ilc.phys.msu.ru/ )

• IONS-Moscow
• Laboratory of solid-state lasers and coherent spectroscopy
• "Lasers and nonlinear optics" practical course laboratory

... Для исследования была взята последовательность белка Malk_ecoli . ... Identities = 214/326 (65%), Positives = 257/326 (78%), Gaps = 13/326 (3%) Query 1 LRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGA 60 LR IAGLE ITSGDLFIGE+RMND P++RGVGMVFQSYALYPHL++ +NMSFGLKL+ A Sbjct 46 LRCIAGLEDITSGDLFIGEQRMNDVEPSKRGVGMVFQSYALYPHLNLYDNMSFGLKLSKA 105 Query 61 KKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLD 120 K I +RV+ AE+LQL+HLLDR+PKALSGGQRQRVAIGRTLV++P+VFLLDEPLSNLD ...

Еще в разделе: (Показать все результаты (>1231) - kodomo.cmm.msu.ru/ )

• Term4
• Term1
• Term2

Moscow State University Chemistry Department . ... for May, 12, 2001 . ... Please, glance these photos and remember everybody! ... registration (Chemical Faculty, see details in Russian page after arrival) . ... Further details will be announced just at 14.30 . To EVERYBODY who have graduated in 1981 and/or entered in 1976. Please, . ... 7(495) 933-0166 (Sergey Kachusov) . 7(495) 939-3877 (Yulya Zakharova) . 7(495) 939-1321 (Galina Tsirlina) . ... up to 10 persons . ... of 1976-1981 . ...

Еще в разделе: (Показать все результаты (>69) - electr003.chem.msu.ru/ )