Электронная библиотека Попечительского совета . ... Kolchin V.F. - Random Graphs . ... Название: Random Graphs . Автор: Kolchin V.F. Аннотация: . Results of research on classical combinatorial structures such as random graphs, permutations, and systems of random linear equations in finite fields. ... Random graph corresponding to random permutation 181 . ... Random graphs with independent edges 100 . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>19387) - lib.mexmat.ru/ )

• Niederreiter H. - Random number generation and quasi-Monte Carlo methods ::
• Fine B., Rosenberger G. - Number Theory: An Introduction Via the Distribution
• Bollobas B. - Random Graphs :: Электронная библиотека попечительского совета

... The numbers of three types of compact binaries containing accreting NSs and BHs, which are most interesting from the point of view of their observational appearances, have been calculated as a function of time: i) X-ray transient source containing a NS in an eccentric orbit around a main sequence Be-star (the observed prototype: A0535+26), ii) BH The evolution of the selected types of X-ray binaries during the first 10 million years after the starburst onset is presented in Fig. ...

Еще в разделе: (Показать все результаты (>675) - xray.sai.msu.ru/ )

• Test of the Initial Mass-Ratio Distribution
• Results
• Frequency distribution of galactic binaries

... 2 from allpy import protein . 3 from allpy.processors import Left . 4 from allpy.util import open . 5 import sys . ... 8 ranges = sys . argv [ 1 ] . 9 infile = open ( sys . ... 10 outfile = open ( sys . ... 12 # This accepts ranges in form "0:5,7:12,1:-1" . 13 ranges = [ map ( int , range . split ( ':' )) for range in ranges . ... 15 alignment = protein . Alignment () . ... 17 columns = alignment . ... from_alignment ( alignment , columns = columns ) . ...

Еще в разделе: (Показать все результаты (>112466) - kodomo.fbb.msu.ru/ )

• allpy: 0e41dc9c60bc
• allpy: ee2c10aa74b8 test/usecase2.py
• allpy: ca2cf2377bed test/usecase1.py

Analysis of the ANTARES data for SN neutrino detection V. Kulikovskiy (MSU / INFN Genova) Hit counts in the detector. The number of hits ( hit counts ) in a time slice (104.8 ms) is used (this information is stored in each run) Mean number of hit counts in one PMT is ~5500 (corresponds to ~55 kHz) Expected number of hits from SN in 100ms is 11.6 ( 550 0) Bioluminescence bursts should be excluded Bioluminescence cut We have collected distributions of hit counts for each ...

Еще в разделе: (Показать все результаты (>23) - antares.sinp.msu.ru/ )

• http://antares.sinp.msu.ru/docs/Shirokov%20-%20The%20first%20results%20of%20MSU%20groups%20in%20ANTARES%20project.pdf
• http://antares.sinp.msu.ru/seminar/Yakovenko.pdf
• http://antares.sinp.msu.ru/docs/2010_Amsterdam_Kulikovskiy.pdf

... K. Krylov . There was undertaken a research of lengthes of marinon - some integral units obtained by segmenting of comleted (whole) fiction prosaic texts (stories, small novels, novels). ... Overall corpus of considereded texts (Russian fiction prosaic) contain more than two million of graphic running words. Undertaken research has lead us to revealing of three main regularities. 1) to formulation of the law of optimum relation between number of elements within each submicroscopic level; . ...

Еще в разделе: (Показать все результаты (>66) - old.philol.msu.ru/ )

... Stationary distribution of product of matrices with random coefficients" . ... The stationary distribution of this chain (the invariant probability measure) defines the characteristics of the limiting behavior of the matrix product. ... As an example, we consider the fundamental matrix of the Jacobi equation with random curvature to compute the invariant measure. ... Keywords: stationary distribution, product of matrices, integral equation, Jacobi equation . PostScript (in Russian) (4.70MB) . ...

Еще в разделе: (Показать все результаты (>546) - num-meth.srcc.msu.ru/ )

• Intermittency of vector fields and natural random number generators
• "Automatic selection of the fastest algorithm implementations"
• "Use of graphics cards and coprocessors for solving filtration problems"

... April 1990 Version 2 of the Reliable Data Protocol (RDP) Status of this Memo This RFC suggests several updates to the specification of the Reliable Data Protocol (RDP) in RFC-908 based on experience with the protocol. ... Changes To The Protocol Header There are three changes to the protocol header: the checksum algorithm has been changed, the port size increased, and the version number incremented. ... RDP now uses the 16-bit TCP checksum, which is specified on page 16 of RFC-793. ... Source Port |...

Еще в разделе: (Показать все результаты (>49213) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1151.txt
• Index of /pub/gentoo-portage/dev-perl/Test-Number-Delta/

Modeling distribution of polymerized anions on the liquidus of the Na 2 O-SiO 2 system . In previous studies, we have presented a STRUCTON computer program designed for statistical simulations of molecular-size distribution of Si-anions in polymerized silicate melts ( Polyakov , Ariskin , 2008). ... in the Na 2 SiO 3 melt. ... Ariskin A.A., Polyakov V.B. Simulation of molecular mass distributions and evaluation of O 2- concentrations in polymerized silicate melts // Geochemistry International. ...

Еще в разделе: (Показать все результаты (>755) - geo.web.ru/ )

• Сайт Number Theory Web - Все о Геологии (geo.web.ru)

... Floating point numbers (AKA "floats", "doubles" or "real numbers") can be specified using any of the following syntaxes: . a = 1.234; $a = 1.2e3; $a = 7E-10; The size of a float is platform-dependent, although a maximum of ~1.8e308 with a precision of roughly 14 decimal digits is a common value (that's 64 bit IEEE format). ... It is quite usual that simple decimal fractions like 0.1 or 0.7 cannot be converted into their internal binary counterparts without a little loss of precision. ...

Еще в разделе: (Показать все результаты (>1169) - oit.cmc.msu.ru/ )

• sesam_fetch_result
• Dealing with a Variable Number of Arguments/Optional Parameters
• Integers

ABOUT ENGINEERING-PSYCHOLOGICAL TEST AT TRAJECTORY CALCULATION KIND, WHICH HAS THE UNIFORMLY DISTRIBUTION OF INTERMEDIATE AND FINAL RESULTS 1 2 3 Zlobin A. I.1, Koganov A. V.2, Rakcheeva T. A.3 NIISI RAN, 117218, Nakhimovsky st. 36, corp. ... If in series C1 the "channel capacity" (CC) increases by increasing of table size, and in C2 series CC do not depend long of trajectory, then we indicate the parallel logic work in C1 seres. ... Approximately the half of experiment members shows parallel work. ...

Еще в разделе: (Показать все результаты (>287) - www.mce.biophys.msu.ru/ )

• Problem about a finding of number of families the locally periodic solutions

Number of cores used . ... Standard MCQDPT2 benchmark using resolvent fitting , Wall clock time and relative speedup . ... Intel Quad-core Core i7 940 2.93 GHz, Asus P6T-Deluxe Mainboard, 6x2GB (triple channel) DDR3-1333 RAM@1333 MHz, Seagate 1 TB SATA-2 ST31000340NS HDD, Windows Server 2008 Enterprise x64. ... Single-point semi-direct two-state MCQDPT2 energy (using resolvent fitting code) for medium-size system (retinal molecule, cc-pVDZ, 565 Cartesian basis functions, CAS(12,12)). ...

Еще в разделе: (Показать все результаты (>117) - classic.chem.msu.su/ )

• The PC GAMESS SMP scaling results for model MP4-SDQ job
• PC GAMESS benchmarks and scalability on SKIF K-1000 - large Infiniband Opteron
• Preliminary PC GAMESS benchmarks on Quad-core Xeon (Clovertown)-based system

Клуб выпускников МГУ (Московский Государственный Университет) . ... The blood test is, when you think about it, a remarkable thing. ... Blood becomes data, and in these numbers lies knowledge about your current health, your risks for disease, and your potential response to treatment. ... The typical blood test report is an exercise in obfuscation, a document that needs to be translated by a lab technician or physician, and that's if you somehow manage to see a copy of your results. ...

Еще в разделе: (Показать все результаты (>441) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: IN VITRO ВЛИЯНИЕ ОПЕРАТОРА ЦИГУН НА ИЗМЕНЕНИЕ

... This program was created for correlating chosen regions in the series of fts images. ... Chosen regions' . ... In this section the program counts the integral for each region of the grid for each image. ... As a matter of fact, the integral is total brightness of the region and it is counted by 'int_tabulated' IDL function. ... In addition, the program will show the count of the regions which correlate with the corresponding region (the brighter region means the bigger count) and its contour. ...

Еще в разделе: (Показать все результаты (>462) - lnfm1.sai.msu.ru/ )

• jg0035
• jg0025
• jg0027

Maximum Parsimony Interpretation of Chromatin Capture Experiments Dirar Homouz, Gang Chen, Andrzej Kudlicki Department of Biochemistry and Molecular Biology Institute for Translational Sciences University of Texas Medical Branch, Galveston, TX, USA The three-dimensional conformation of the genome plays an important role in gene regulation at a wide range of scales, including the distribution of the nucleosomes, the folding of chromatin , as well as chromosomal ...

Еще в разделе: (Показать все результаты (>300) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/134.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/33.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/140.pdf

... Length = 434 Score = 41.2 bits (95), Expect = 0.001 Identities = 33/99 (33%), Positives = 49/99 (49%), Gaps = 4/99 (4%) Frame = +2 Query: 6713 ALFDVGQARLKDGSTKVLINALVNIRARPGWLIVVTGYTDT ... EAVRDWMLQTSDIPATFFAVQGLGESHPAATNDTPEGRA 6997 V +L + +PA + G G++ P A N + GRA Sbjct: 386 AEVAA-LLTSGGVPAGRVHIVGKGDTVPVADNGSKAGRA 423 Database : sal Posted date: Oct 3, 2006 6:42 PM Number of letters in database : 1, 395 ,779 Number of sequences in ...

Еще в разделе: (Показать все результаты (>5442) - kodomo.cmm.msu.ru/ )

• TMHMM result

IVP Test Set . Both engineers and computational scientists alike will benefit greatly from having a standard test set for Initial Value Problems (IVPs) which includes documentation of the test problems, experimental results from a number of proven solvers, and Fortran subroutines providing a common interface to the defining problem functions. ... This test set tries to fulfill these demands and tries to set a standard for IVP solver testing. ... None . ... SAL Home | Numerical Analysis | ...

Еще в разделе: (Показать все результаты (>3761) - www.sai.msu.su/ )

• Zen: GinTest
• Zen: SkyPixelization
• SAL- Mathematics - Statistics -- statist

... Topology inquiry functions . ... If a topology has been defined with one of the above functions, then the topology information can be looked up using inquiry functions. ... MPI_TOPO_TEST(comm, status) . ... OUT status] topology type of communicator comm (choice) . int MPI_Topo_test(MPI_Comm comm, int *status) . ... The function MPI_TOPO_TEST returns the type of topology that is assigned to a communicator. ... int MPI_Graphdims_get(MPI_Comm comm, int *nnodes, int *nedges) . ... Центры . ...

Еще в разделе: (Показать все результаты (>679) - www.parallel.ru/ )

• Associating Information with Status | PARALLEL.RU - Информационно-аналитический
• Cartesian Convenience Function: MPI_DIMS_CREATE | PARALLEL.RU -
• General (Graph) Constructor | PARALLEL.RU - Информационно-аналитический центр

... Example: %CALC{"$INT( 10 / 4 )"}% returns 2 . ... Example: %CALC{"$LENGTH(abcd)"}% returns 4 . ... Example: %CALC{"$LIST( $LEFT() )"}% returns Apples, Lemons, Oranges, Kiwis assuming the cells to the left contain | ... Example: %CALC{"$LOWER( $T(R1:C5) )"}% returns the lower case string of the text in cell R1:C5 . ... Example: To find the biggest number to the left of the current cell, write: %CALC{"$MAX( $LEFT() )"}% . ... Example: %CALC{"$TODAY()"}% returns the number of seconds since Epoch . ...

Еще в разделе: (Показать все результаты (>42681) - dualopt1.cmm.msu.ru/ )

• %TOPICTITLE% (57 vs. 61) - TWiki
• %TOPICTITLE% (13 vs. 14) - TWiki
• %TOPICTITLE% (60 vs. 61) - TWiki

System parameters on Digital UNIX . ... Digital and Cray use the number of bytes as the KIND -parameter. ... LOGICAL Default byte word KIND number = 4 1 4 LOGICAL Default double quad KIND number = 4 8 16 INTEGER int15 int31 int63 KIND number = 2 4 8 digits = 15 31 63 radix = 2 2 2 range = 4 9 18 huge = 32767 2147483647 9223372036854775807 bit_size = 16 32 64 REAL single double quad KIND number = 4 8 16 digits = 24 53 113 maxexponent = 128 1024 16384 minexponent = -125 -1021 -16381 ...

Еще в разделе: (Показать все результаты (>6002) - crydee.sai.msu.ru/ )

• Naughty Number Nine
• Three Is A Magic Number
• Springer LINK:A&A-EE: Table of Contents Volume 323 Number 3 (1997)

Brain Research Group >> Research >> Change-point analysis ... << previous next >> . ... The number of randomly coinciding change-points (the noise level) can be easily estimated using the total numbers of change-points in each EEG channel, and thus the estimate of the number of systematically coinciding change-points can be cleared from the randomly coinciding change-points, both "true" and "false". ... This number, however, vary with the number of change-points in each channel. ...

Еще в разделе: (Показать все результаты (>63) - brain.bio.msu.ru/ )

• Change-points in multi-channel EEG