... Mathematical Theory of Feedback Control . ... Annotation: this course is about mathematical equations of atmospheric diffusion which allow modeling of the problems of environment. ... The course reflects the experience and the point of view of a research group in the field of mathematical modeling of Western, Soviet and later Russian economics. ... Such approach captures the behavior of rather complex systems. ... Scientific Seminar: Mathematical Modeling of Complex Systems . ...

Еще в разделе: (Показать все результаты (>18) - hcs.cmc.msu.ru/ )

• User account | Магистерское и послевузовское образование
• Master program "Open Information Systems" | Магистерское и послевузовское
• Master Education | Магистерское и послевузовское образование Entrance

... 001.89:004 .. , .. , .. , .. , .. , .., .. e-mail: kryukov@theory.sinp.msu.ru RESTFUL-- 2012-4/882 RESTful-- , : , , , UNIDATA Common Data Model, , , , , , . ... NCEP/NCAR [1], , ). , . ... RESTful-- , : , , , UNIDATA Common Data Model [2], , , , , , . ... UNIDATA Common Data Model (CDM) [2]. ... UNIDATA CDM 3. ... XML . ... Unidata Common Data Model. : http://www.unidata.ucar.edu/software/netcdf-java/CDM/ [3]. ... Network Common Data Form (NetCDF). : http://www.unidata.ucar.edu/software/netcdf/ [5]...

Еще в разделе: (Показать все результаты (>4) - sinp.msu.ru/ )

• SINP MSU

... Next Routine] [List of Routines] NAME: ADD_HEADER PURPOSE: addition information from FITS-headers MPFS-frames DESCRIPTION: The function computes the total exposure, mean value zenit distance and modified FITS header CALLING SEQUENCE: Result =ADD_HEADER( headers ) CATEGORY: reduction MPFS-data INPUTS: Headers = String array FITS-headers from the MPFS data OUTPUTS: Header = String array containing the header from the FITS file. ... OPTIONAL INPUT KEYWORD PARAMETERS: BEFORE = Keyword string name. ...

Еще в разделе: (Показать все результаты (>46) - sn.sai.msu.ru/ )

. Home . News . Studying at MU . Exchanges . Contacts . Search . Lost your Password? . Please enter your Username and e-mail address then click on the Send Password button. You will receive a new password shortly. Use this new password to access the site. Username: . E-mail Address: . Lomonosov Moscow State University . International Relations Office 2007-2008

Еще в разделе: (Показать все результаты (>9) - www.ied.msu.ru/ )

• International Office of Moscow University - Foreign partners
• International Office of Moscow University - About us

Summary Progress Report 2010 ­ 2014 UNESCO Chair on Global Problems and Emerging Social and Ethical Challenges for Large Cities and Their Population at the Faculty of Global Processes of the Lomonosov Moscow State University Period of activity: September 2010 June 2014 Title of the Chair : UNESCO Chair on Global Problems and Emerging Social and Ethical ... Visit of UNESCO Director-General Irina Bokova at Moscow State University September 9, 2011. ...

Еще в разделе: (Показать все результаты (>1589) - fgp.msu.ru/ )

• Search Results п¤п“пџ пњп“пе пёпј. пњ.п’. п›пѕпјпѕпЅпѕяЃпѕпІп°

Moscow Astronomical Plate Archives: . Contents, Digitization, Current and Possible Applications . ... We describe the astronomical plate archives in Moscow and Zvenigorod and the existing digitization projects. ... 2 The Plate Archive of the Sternberg Institute . The contents of the most important Moscow astronomical plate archive, that of the Sternberg Astronomical Institute, was briefly presented in Shugarov et al. [1] in 1999. ... THE MOSCOW PLATE COLLECTION (STERNBERG INSTITUTE) . ...

Еще в разделе: (Показать все результаты (>28) - www.sai.msu.ru/ )

• Отдел внегалактической астрономии: ГАИШ Extra-galactic astronomy Group Staff

My Teachers . Kh.A. Rakhmatulin . ... U.M. Dubova-Sergeeva . ... Kh.A. Rakhmatulin's works reflect a wide range of his scientific interests. Fundamental results, obtained by him, have a great scientific and applied significance in many fields of modern mechanics: . ... Meritorious Art Worker of Russia Undina Mikhailovna Dubova-Sergeeva was founder and head of M.Lomonosov Moscow State University Piano Class, from 1936 till 1986. ...

Еще в разделе: (Показать все результаты (>6) - margaret.imec.msu.ru/ )

• A Little History

... Science interests . ... Awards . ... Russian . ... European Materials Research Society Young Scientist Award . ... VIII Russian Mendeleev Society for student's research work on chemistry . 1st Award . ... XI Russian Mendeleev Society for student's research work on chemistry . 3st Award . ... International Conference on Fundamental Science . ... April 2000) . ... 3rd Award . ... VII Conference "Actual problems of modern inorganic chemistry and materials chemistry" . ... 6 Russian conference . ...

Еще в разделе: (Показать все результаты (>54) - www.inorg.chem.msu.ru/ )

• Petr S. Berdonosov
• Group of Hydrothermal Synthesis :: News
• Inorganic Synthesis Laboratory - Supramolecular and Cluster Compounds

... June 9, 1999 . NGC 4414: A Telling Spiral . ... the Hubble Heritage Team ( AURA / STScI / NASA ) . Explanation: How far away is this galaxy? ... Spiral galaxy NGC 4414 contains many Cepheid variable stars that oscillate in a way that allows astronomers to estimate their distance. ... NGC 4414 shows many classic spiral galaxy features, including thick dust lanes , a central region rich in old red stars, and winding spiral arms glowing with young blue stars. ... About APOD > . ...

Еще в разделе: (Показать все результаты (>30) - www.arcetri.astro.it/ )

... Academic . ... Academic Departments . ... Partners . Conferences . ... All partners . ... The international academic conference . ETHNIC PRESS GENESIS, STRUCTURE, DEVELOPMENT TRENDS . ... Conference proceedings will be published at the endљ . of the Conference as a collection of scientific articles and available in electronicљ . ... Organizing Committee address: Department of Journalism, Room 325 A, 3d floor, Main Academic Building, 42 Kulakovskogo St., Yakutsk, 677000. ...

Еще в разделе: (Показать все результаты (>99) - www.journ.msu.ru/ )

• The Third All-Russian NAMMI conference ?Topical Issues in Media Studies-2014?
• The visit of the students from Saxion University of Applied Sciences of the
• The Second International Media Readings in Moscow

... President George W. Bush Department of Education Strategic Goals: Goal One: Create a Culture of Achievement Create a culture of achievement by effectively implementing the president's plan, No Child Left Behind, and by basing all federal education programs on its principles: accountability, flexibility, expanded parental options, and doing what works. ... Goal Six: Establish Management Excellence Create a culture of accountability throughout the Department of Education. ... accountability | ... line...

Еще в разделе: (Показать все результаты (>3) - www.edst.msu.ru/ )

University Satellites and . Space Science Education . ... Use of microsatellite technology in aerospace education by the example of BAUMANETS microsatellite project . ... Launch is scheduled for March 2006. ... Over 20 students graduated from BMSTU and found work in leading Russia s and international aerospace companies. ... Meanwhile, modern labor market in aerospace shows increasing requirements towards quality of university education. ...

Еще в разделе: (Показать все результаты (>426) - cosmos.msu.ru/ )

• Space Scientific and Education project of Lomonosov Moscow State University

Tentative academic program of Summer School in Coastal Ecology and Biological Safety (June 14-26, 2010; White Sea Biological Station) Version of January 27, 2010 Module I (4 days ): Invertebrates' Diversity of Coastal Zone Lectures + seminars, boat and short hiking excursions, laboratory work , individual work a) Main groups of invertebrates: the resident and endemic species of the W hite Sea b) Gathering and ...

Еще в разделе: (Показать все результаты (>8) - www.bio.msu.ru/ )

• Master In Ecology ? Биологический факультет МГУ

... Chair of Computer Methods of Physics . Department of Physics, M.V. Lomonosov Moscow State University . Create new account . ... Request new password . Username * . Enter your Chair of Computer Methods of Physics username. Password * . Enter the password that accompanies your username. ... Department of Physics M.V. Lomonosov Moscow State University , Chair of Computer Methods of Physics , 2014 . ... Let us know ! ...

Еще в разделе: (Показать все результаты (>3) - cmp.phys.msu.ru/ )

. English . Русский . Navigation . Главная . О лаборатории . Новости . Состав лаборатории . Наука . Публикации . Обучение . Контакты . Wiki . Webmail . Create new account . Log in (active tab) . Request new password . Username * . Enter your Лаборатория нанооптики и метаматериалов username. Password * . Enter the password that accompanies your username. Search .

Еще в разделе: (Показать все результаты (>203) - nanolab.phys.msu.ru/ )

• User account | Laboratory of Nanophotonics & Metamaterials
• Maxim Shcherbakov in the media | Laboratory of Nanophotonics & Metamaterials
• Teaching | Laboratory of Nanophotonics & Metamaterials

... in English . ... Switch to English . ... Armenia, 0048, Yerevan, Davidashen 25 . ... The present work is dedicated to development of new polymer compositions used to protect units of atomic techniques and environment by means of deactivation of various surfaces from ?-, ?-, ?-radioactive pollutions. ... In both cases (applications) mechanism of ionizing radiation influence is determined by general principles of its interaction with organic molecules and organic-inorganic structures of macromolecules...

Еще в разделе: (Показать все результаты (>85) - www.msm.biophys.msu.ru/ )

Head of sector, acting head of the Computational Geophysics Division of the M.V. Keldysh Institute for Applied Mathematics, RAS. ... Finished the Electrodynamics and Quantum Theory Department of Faculty of Physics, MSU in 1962. ... Ill-posed problems, stochastic processes, theory of approximation. Mechanics and physics of multi-phase media, phenomena in porous media, difference schemes for some classes of mathematical physics problems (filtration, elasticity theory). ...

Еще в разделе: (Показать все результаты (>2) - compmech.math.msu.su/ )

... e-mail: zabaev-iv@yandex.ru) .. , " " - (e-mail: evprutskova @gmail.com) , , , , sociology of religion, parish research, parish sociology, social work, Russian Orthodox Church , . The article discusses the bases for the Orthodox parish community concept construction and operationalization, and analyzes the factors contributing to community development. ... The study includes a quantitative survey of priors, priests, parishioners, and social workers of Moscow parishes. ...

Еще в разделе: (Показать все результаты (>57) - vestnik.socio.msu.ru/ )

• http://www.socio.msu.ru/vestnik/archive/2011/4/03.pdf
• http://www.socio.msu.ru/vestnik/archive/2013/4/14.pdf
• http://www.socio.msu.ru/vestnik/archive/2010/2/04.pdf

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>12) - storage.bioinf.fbb.msu.ru/ )

• Roman Sutormin. Home Page

... Each year about 25 new students (3rd year of education) who want to have special education not only in chemistry but also in life sciences join our department. ... They can choose one of two specializations: Physical Chemistry of Enzymes or Enzyme (Protein) Engineering. ... There is a new lecture course for all students studying at the Faculty of Chemistry concerning Chemical outlook to life sciences given by Prof. S.D.Varfolomeev. ... Enzyme kinetics (4th year of education) (Prof. A.V.Levashov). ...

Еще в разделе: (Показать все результаты (>120) - www.enzyme.chem.msu.ru/ )

• On-line registration
• index
• Members of Genetic and Protein Engineering Group