Lomonosov project . ... Mikhail Lomonosov . ... The studies of Lomonosov determined profile of Russian science forever, and we appreciate the discoveries of the leading Russian scientists as the studies of his direct learners and successors. A recognized and the most significant input of Lomonosov into natural science is molecular-kinetic theory of heat, developed during the prevalence of theory of specific fiery matter ? ... Lomonosov?s theory drawn wide response in European science. ... Aurora. ...

Еще в разделе: (Показать все результаты (>20) - lomonosov.sinp.msu.ru/ )

Home Search Collections Journals About Contact us My IOPscience On the problem of the spontaneous exchange-driven electron interwell re-population in semiconductor quantum wells This article has been downloaded from IOPscience. ... The wave function for an electron in the second well has a similar form. ... Now our goal is to prove that for any electron state with all electrons in one well one can build another state with electrons equally populating both wells, which is lower in energy. ...

Еще в разделе: (Показать все результаты (>16) - lizard.phys.msu.su/ )

• http://lizard.phys.msu.su/home/science/redistr-sst99.ps.gz
• http://lizard.phys.msu.su/home/science/jap-06.pdf
• http://lizard.phys.msu.su/home/science/physE-2001.ps.gz

Electron and proton impact ionization of atoms and molecules . Theory of few-body Coulomb scattering This is one of the major topics in the research activity of our laboratory. ... Electron momentum spectroscopy (EMS) EMS is the (e,2e) method involving high incident energy and large momentum transfer. ... We develop a theory of the single- and double-ionization EMS processes in atomic and molecular systems. ... c) Laboratory of mathematical models of quantum scattering processes, 2012 . ...

Еще в разделе: (Показать все результаты (>8) - lmmqsp.sinp.msu.ru/ )

Welcome to Fourmilab 's calendar converter! ... In the Julian calendar every fourth year is a leap year in which February has 29, not 28 days, but in the Gregorian, years divisible by 100 are not leap years unless they are also divisible by 400. ... The average length of a year is 365.2468 days compared to the actual solar tropical year (time from equinox to equinox) of 365.24219 days, so the calendar accumulates one day of error with respect to the solar year every 216 years. ... Excel serial day: . ...

Еще в разделе: (Показать все результаты (>13) - sbmg.geol.msu.ru/ )

... 2000 December 15 . IC443's Neutron Star . ... Explanation: Using x-ray data from the orbiting Chandra Observatory along with radio data from the Very Large Array , a team of researchers has discovered evidence for a new example of one of the most bizarre objects known to modern astrophysics -- a neutron star . ... The core collapsed when the star, located a reassuring 5,000 light-years away in the constellation Gemini , exploded long ago. How long ago? ... About APOD | ... NASA Technical Rep.: ...

Еще в разделе: (Показать все результаты (>36) - www.arcetri.astro.it/ )

• APOD: May 25, 1999 - NGC 6872: A Stretched Spiral
• APOD: 2000 June 21 - Solstice Celebration
• APOD: 2000 March 12 - Supernova 1994D and the Unexpected Universe

... In a sphere-plane geometry, routinely used in atomic force microscope and surface force apparatus, it can form a bridge connecting the surfaces. ... By minimizing the free energy of a binary mixture we obtain the force-distance curves as well as the structural phase diagram of the configuration with the bridge. Numerical results predict a discontinuous transition between the states with and without the bridge and linear force-distance curves with hysteresis. ... Phys., Vol. ...

Еще в разделе: (Показать все результаты (>34) - nanofluidics.phys.msu.ru/ )

• http://nanofluidics.phys.msu.ru/paper/jcis3.pdf
• http://nanofluidics.phys.msu.ru/paper/pf2007.pdf
• Publications

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/bmc_genom_2013.pdf

INNER POLAR RINGS REGULAR LENTICULAR GALAXIES 1 K. Sil'chenko 2 Sternberg Astronomical Institute, 119992 Moscow, Russia; Isaac Newton Institute Chile, Moscow Branch; olga@sai.msu.su Afanasiev Special Astrophysical Observatory, 369167 Nizhnij Arkhyz, Russia; vafan@sao.ru Received 2003 December accepted February 4 ABSTRACT have investigated a sample of galaxies, mostly with circumnuclear dust lanes orthogonal their major axes, chosen from Hubble Space Telescope Wide Field Planetary Camera 2 images. ...

Еще в разделе: (Показать все результаты (>47) - sn.sai.msu.ru/ )

• MPFS reduction routines HELP

... Unit I. Geologic Hazards and Man Unit II. ... Amazing Earth. ... Трансформируйте словосочетания в предложения. 1. geologic processes going on for millions of years 2. any geologic process can become a geologic hazard 3. some geologic hazards having resulted in disaster 4. many geologic hazards have affected the activity of man 5. a lot of earthquakes resulting in landslides 6. some naturally occurring hazards 7. many disasters are caused by geologic hazards 8. some ...

Еще в разделе: (Показать все результаты (>4) - geol.msu.ru/ )

. Пользователям: . Авторизация . Регистрация . Поиск по МГУ | Лента новостей | В картинках | Работа | Форум | MsuWiki | Карты | Ссылки | Партнеры | О проекте . Форумы > Новости МГУ > Профайл пользователя . Форумы Список тем . login [ Найти все посты ] . Посты: . 1 . Дата регистрации: . 16.01.2010 16:37 . Последний визит: . 16.01.2010 16:39 . 2003 2011 MsuNews.Ru Новости МГУ . 2003 2011 Разработка и дизайн MMForce.Net . О проекте | Обратная связь | . Условия использования | Экспорт новостей (RSS)

Еще в разделе: (Показать все результаты (>43) - www.msunews.ru/ )

• MsuNews.Ru
• MsuNews.Ru | Новости МГУ | Междисциплинарный семинар по времени продолжает

... Radical Polymerization as an Indicator Reaction for Determination of Organic Compounds M. K. Beklemishev, I. V. Nikolaev, and L. Yu. ... The effect of 26 model organic compounds on the polymerization rate has been studied. ... Effect on model compounds on VP and MMA polymerization. ... At low radical concentrations (i.e., in the case of MMA), a considerable fraction of radicals can be trapped by almost any model compound; most of these compounds will decrease the overall polymerization rate. ...

Еще в разделе: (Показать все результаты (>30) - analyt.chem.msu.ru/ )

• http://analyt.chem.msu.ru/kinetics/papers/Luchinina%20Galimova%20Ascorbic%20acid%20%20Anal.%20Chem%20Acta%202006.pdf
• http://analyt.chem.msu.ru/kinetics/papers/Bagirova%20Effect%20of%20Mercury(II)%20Traces%20Anal%20Lett.%202006.pdf
• http://analyt.chem.msu.ru/kinetics/papers/Enzymatic%20phenols%20using%20peanut%20peroxidase%20Talanta%2055%202001.pdf

... An approach to the hybrid quantum mechanical and molecular mechanical (QM/MM) theory based on the effective fragment potential (EFP) technique (M. Gordon and co-authors) for modeling properties and reactivity of large molecular systems of biochemical significance is being developed. Currently we are preparing a novel version of the computer program based on the most recent variant of the PC GAMESS quantum chemistry package (A. A. Granovsky) and the TINKER molecular modeling package (J. Ponder). ...

Еще в разделе: (Показать все результаты (>11) - lcc.chem.msu.ru/ )

... The Informativeness of Coherence Analysis in EEG Studies A. P. Kulaichev UDC 612.821.6 Translated from Zhurnal Vysshei Nervnoi Deyatel'nosti imeni I. P. Pavlova, Vol. ... KEY WORDS: coherence, spectral analysis, EEG non-stationarity, amplitude modulation. ... In particular, the two fundamental differences between EEG signals and most other physical signals are not considered: a) fundamental non-stationarity; b) amplitude modulation at all frequency ranges. ... Coherence in technical addenda. ...

Еще в разделе: (Показать все результаты (>11) - www.protein.bio.msu.ru/ )

• http://www.protein.bio.msu.ru/~akula/Kulaichev%20Addition.pdf

... Radical changes in the life of the country at the end of the twentieth century put the Moscow University within the need of maintaining a high level of classical university education in the new environment. ... In June 2006 the Academic Council of the Moscow State University has decided to establish a new Faculty - Higher School of Management and Innovation (Corporate University) - jointly with JSFC "Sistema" . ... MSU website . ... 2006-2016 MSU Higher School of Management and Innovation. ...

Еще в разделе: (Показать все результаты (>7) - hsmi.msu.ru/ )

DAYS on DIFFRACTION' 2011 77 Analytical solutions for diffraction problem of nonlinear acoustic wave b eam in the stratified atmosphere Vladimir A. Gusev, Ruslan A. Zhostkow Department of Acoustics, Physical Faculty, Lomonosov's Moscow State University, Russia; e-mail: vgusev@bk.ru The nonlinear wave equation and mo dified Khokhlov­Zab olotskaya typ e equation for high intensive acoustics wave b eams propagating in stratified atmosphere with inhomogeneous of sound sp eed is set up. ...

Еще в разделе: (Показать все результаты (>45) - acoustics.phys.msu.ru/ )

• http://acoustics.phys.msu.su/teachers/gusev_files/diff2012.pdf
• http://acoustics.phys.msu.su/teachers/rudenko_files/98sweisarv.pdf
• http://acoustics.phys.msu.su/teachers/shanin_files/~shanin/papers/dd10proc.pdf

... Linguistic expeditions . ... Logical and stylistic aspects of lexical semantics . ... Linguistic phenomena can be approached and described from various perspectives. ... The approach proposed here is distinctive in that it is based on logic and stylistics, which are usually considered marginal to the description of linguistic phenomena. ... A special focus in the present approach on parallel texts is directly connected with translation . ...

Еще в разделе: (Показать все результаты (>15) - lcl.srcc.msu.ru/ )

... Fast Facts about the Faculty of Journalism . ... Academic Departments . ... Partners . ... All partners . ... The Faculty of Journalism, Lomonosov Moscow State University has a long legacy of academic excellence, and we continue to build on that legacy in ways that prepare students to succeed as media professionals in a rapidly changing world. ... Thank you for your interest in the Faculty of Journalism. ... 1999-2014 Faculty of Journalism, Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>36) - www.journ.msu.ru/ )

• Lecture of Professor Robert Weisbrot (Colby College, USA) :: Department of
• The 5th International Media Readings in Moscow "Mass Media and Communications ?
• Television and Radio Broadcasting :: Department of Journalism, M. V. Lomonosov

... N 1 Contents Buzhilova A.P. Anthropology at the Moscow University (to the 90 anniversary of Institute of Anthropology of the Moscow State University) (p. 4) Review. Historical development of the main trends in scientific research of the Institute and Museum of Anthropology, Lomonosov Moscow State University, is discussed. ... The article discusses the formation and development of ethnic anthropology in the Research Institute of Anthropology, Lomonosov Moscow State University from 1922 onwards. ...

Еще в разделе: (Показать все результаты (>22) - www.anthropos.msu.ru/ )

• http://www.antropos.msu.ru/zzx/11_2_en.doc
• http://www.antropos.msu.ru/vestnic/e2014_4.doc
• http://www.antropos.msu.ru/vestnic/e2014_2.doc

Create user account [Комиссия по практикуму, 3 семестр, 2015-2016] . login: . e-mail: . ... Use an existing account . To create an account, please think out, a login and provide your valid e-mail address in the form above. Then press the \"Create account\" button. Login may contain only latin letters, digits, . ... Use this password for the first log in. ... If you already have an ejudge account on this server, you may use it. If so, follow the link: Use an existing account . ...

Еще в разделе: (Показать все результаты (>17) - acm.msu.ru/ )

• Create user account [Комиссия, 3 семестр, 2014-2015]
• Create user account [Комиссия, 4 семестр, 2014-2015]
• Create user account [ACM ICPC 2015-2016, NEERC, Moscow Subregion, Training]

Draft Dr. Paul Twomey President and Chief Executive Officer Internet Corporation for Assigned Names and Numbers (ICANN) Speech to Third International Forum Partnership Among State, Business Community and Civil Society in Ensuring Information Security Garmisch-Partenkirchen, Germany Monday, 20 April 2009 Dear Vladislav Petrovich, Dear Alexei Anatolievich, Distinguished guests, Ladies and Gentlemen. ... ICANN itself is evolving, mirroring the changing nature of the global Internet community. ...

Еще в разделе: (Показать все результаты (>13) - iisi.msu.ru/ )

• http://www.iisi.msu.ru/UserFiles/File/bayern2009/perl.doc
• http://www.iisi.msu.ru/UserFiles/File/bayern2009/global_dns.pdf