... Many of these planetesimals had metallic iron cores and during growth of the Earth this metal re-equilibrated with the Earth's silicate mantle, extracting siderophile (`iron-loving') elements into the Earth's iron-rich core. ... Chemical signature of core formation Growth of the Earth from planetary embryos and planetesimals resulted in the substantial partitioning of siderophile elements into the metallic core, leaving lithophile elements behind in the silicate mantle. ... REE, rare-earth elements....

Еще в разделе: (Показать все результаты (>13) - ocean.phys.msu.ru/ )

• http://ocean.phys.msu.ru/courses/geo/lectures-addons/15/2001%20Demorest%2C%20Dynamo%20theory%20and%20Earth's%20magnetic%20field%20.pdf
• http://ocean.phys.msu.ru/courses/stathyd/2001%20Ferrari%20et%20al.%2C%20The%20temperature-salinity%20relationship%20of%20the%20mixed%20layer.pdf
• http://ocean.phys.msu.ru/courses/geo/lectures-addons/12/2004%20Kanamori%2C%20%20Brodsky%20The%20Physics%20of%20Earthquakes.pdf

MGU Botanic Garden . ... The MSU Botanical Garden is not only a valuable scientific institution, but also a place giving joy and a good mood to many people. ... To become a volunteer, please, fill in the application e-form and send it to the following e-mail address: . ... We will contact you on your telephone number within a week of your sending the application. Community work days are also held on the territory of the Garden for different organization and agency workers. ...

Еще в разделе: (Показать все результаты (>7) - botsad.msu.ru/ )

Главная Программа Материалы - Конспекты - Задачи Электрожурнал Успеваемость Преподавателям . ... Identifier expected . ... Error in real constant . ... Error in integer constant . ... Возможно, отсутствует кавычка в конце строковой константы. ... Invalid filename . ... Integer constant expected . ... Integer or real constant expected . ... BEGIN expected . ... Integer expression expected . ... Integer or real expression expected . ... Integer variable expected . ... Integer or real variable expected . ...

Еще в разделе: (Показать все результаты (>2) - us.chem.msu.su/ )

... Математический семинар Глобус. 11 марта 2004 г. 11 марта 2004 года (четверг) в 15:40 в конференц-зале НМУ, Б. Власьевский, 11 состоится очередная лекция семинара Глобус "Random walks along orbits of chaotic maps". ... T^d be a measure preserving map of a d-dimensional torus T^d with a smooth measure \mu. ... 0,1) be a smooth (random environment) function. Consider a random walk. A point x\in T^d jumps to the image fx with probability p(x) and into the preimage f^{-1}x with probability 1-p(x). ...

Еще в разделе: (Показать все результаты (>212) - www.mmonline.ru/ )

• Математический семинар Глобус 27 мая
• Математический семинар Глобус, заседание 1 июня 2006 г.
• MMOnline | Новости | Математический семинар Глобус. 11 марта 2004 г.

... A comparative study of thermodynamic for both natural and artificial RNA/DNA ґ protein complexes would establish bases for a specificity of complex formation. In particular, we have shown that aptamers could be used for a direct measuring of thrombin enzymatic activity in a solution. D 2002 Published by Elsevier Science B.V. Keywords: RNA/DNA ґ protein interactions; Ribosome; SELEX; RNA/DNA aptamers; Thrombin; Enzymatic activity 1. ... The aptamer binds to the protein with Kd = 0.5 nM. ...

Еще в разделе: (Показать все результаты (>6) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.ru/pages/pdf/nar2004.pdf
• http://rnp-group.genebee.msu.ru/pages/pdf/biochem2002_1.pdf
• http://rnp-group.genebee.msu.su/pdfs/MolBio6_00KopylovLO.pdf

May 12, 1998 NOTES from May 9, 1998: The format of the Solar Event Lists was changed to include a standard SEC style header. ... Please send comments and suggestions to sec@sec.noaa.gov # # Missing data: //// # # Edited Events for 1998 May 11 # # Event Begin Max End Obs Q Type Loc/Frq Particulars Reg# #------------------------------------------------------------------------------- 2560 A0146 //// 1225 HOL ... The UT day of the event's begin time is the UT day of the list. ...

Еще в разделе: (Показать все результаты (>7) - dbserv.sinp.msu.ru/ )

C ALL FOR CONTRIBUTIONS EABIS 11th ANNUAL COLLOQUIUM HOSTED BY IMD LAUSANNE, JULY 3-4, 2012 "STRATEGIC INNOVATION FOR SUSTAINABILITY" A BOUT THE COLLOQUIUM The EABIS Annual Colloquium is an international forum that brings together 250-300 senior figures from industry, academia, policy-making and civil society. ... IMD's long-standing Corporate Sustainability Management (CSM) Platform is a corporate membership and multi-faculty driven research & learning initiative that is now linked to the new Center. ...

Еще в разделе: (Показать все результаты (>130) - www.mgubs.ru/ )

• http://www.mgubs.ru/images/Image/IFP%202011%20brochure.pdf
• Директор York Associates провел семинар для магистров ВШБ МГУ
• Высшая школа бизнеса МГУ им. Ломоносова

... Phys . B 74, 653 ґ 659 (2002) DOI: 10.1007/s00340-002-0917-5 Applied Physics B Lasers and Optics t.v. dolgova1 d. schuhmacher2 g. marowsky2 ... April 2002 Published online: 6 June 2002 Ї ? Springer-Verlag 2002 ABSTRACT The technique of combined optical secondharmonic (SH) intensity and phase spectroscopy, which is the spectroscopic modification of SH ... 2 Theory The SH phase and intensity spectra reflect spectral dependences of optical susceptibilities and Green's function corrections. ...

Еще в разделе: (Показать все результаты (>34) - shg.phys.msu.ru/ )

• http://shg.phys.msu.ru/ruscon/articles/pdf/04_LasPhys_14_MPC.pdf
• http://shg.phys.msu.ru/ruscon/articles/pdf/02_JETP_75.pdf

... Zhang R., Min W., Sessa W.C. Functional analysis of the human endothelial nitric oxide synthase promoter: Spl and GATA factors are necessary for basal transcription in endothelial cells. ... Genetic Contribution of the Endothelial Constitutive Nitric Oxide Synthase Gene to plasma Nitric Oxide Levels. ... Ichihara S., Yamada Y., Fujimura Т., Yokota M. Association of a Polymorphism of the Endothelial Constitutive Nitric Oxide Synthase Gene With Myocardial Infarction in Japanese Population. ...

Еще в разделе: (Показать все результаты (>409) - www.nature.web.ru/ )

• Современные возможности изучения свойств штаммов Helicobacter pylori больных с
• В плену у совершенства
• ТИГР на воздушном шаре

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>8) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/batmas30.pdf

: .. , . .. ( e-mail: alanov87@gmail.com) , , , , , , socio -cultural situation, Tradition, Innovation, modern Russian society, spirituality, valuables , , . . In the following article the range of issues associated with modern Russian society social and cultural situation is analyzed. The latter is considered the synthesis of tradition and innovation. The innovation is seen as the reproduction of traditions in the new environment and on the whole new level.

Еще в разделе: (Показать все результаты (>54) - vestnik.socio.msu.ru/ )

• http://www.socio.msu.ru/vestnik/archive/2010/3/06.pdf

... Interaction classes . ... List of Contact Types: . ... Contact with Major Groove of DNA by helices, loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by strands, loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by any element(s) and Minor Groove by helices, loops . ... Contact with Major Groove of DNA by any element(s) and Minor Groove by loops . ...

Еще в разделе: (Показать все результаты (>7) - npidb.belozersky.msu.ru/ )

• NPIDB: Home

SELECT data_key, data_value FROM xf_data_registry WHERE data_key IN ('options', 'languages', 'contentTypes', 'codeEventListeners', 'cron', 'simpleCache', 'routesPublic', 'bannedIps', 'styles', 'nodeTypes', 'smilies', 'bbCode', 'displayStyles', 'trophyUserTitles', 'reportCounts', 'moderationCounts') . ... Select Type . ... Ref . ... SIMPLE . ... PRIMARY . ... const . ... library/XenForo/ Autoloader.php . ... library/Zend/Registry.php . ... library/Zend/Config.php . ... library/Zend/Db/Select.php . ...

Еще в разделе: (Показать все результаты (>26) - osk.msu.ru/ )

• http://osk.msu.ru/forum/members/adollekautoto.2142/?_debug=1
• http://osk.msu.ru/forum/members/arbimeorirm.2192/?_debug=1
• http://osk.msu.ru/forum/members/catyfopwbex.2168/?_debug=1

... Начало www.99ru.ru Книги о РУСИ Славянская традиция 8265 . ... Искусство . История.Философия . ... Художественные . ... История Всемирная . ... Искусство и культура . ... Другие виды искусства . ... Этнография Фольклор . ... Наследие Востока . ... Введите код товара из каталога. автор Велецкая Н.Н. Символы славянского язычества. руб. ... Велецкая Н.Н. Символы славянского язычества. ... Автор этой книги, отечественный славист с мировым именем - Наталья Николаевна Велецкая, делает такую попытку. ...

Еще в разделе: (Показать все результаты (>10) - www.bukivedi.ru/ )

Appl Phys B DOI 10.1007/s00340-010-4081-z Multifilamentation of high-power femtosecond laser pulse in turbulent atmosphere with aerosol E.P. Silaeva Ї S.A. Shlenov Ї V.P. Kandidov Received: 18 February 2010 / Revised version: 29 April 2010 ? Springer-Verlag 2010 Abstract The filamentation of a femtosecond laser pulse in atmosphere under the joint influence of turbulence and aerosol has been numerically studied for the first time. ... Strong turbulence can inhibit the pulse filamentation process. ...

Еще в разделе: (Показать все результаты (>70) - ilc.phys.msu.ru/ )

• "Computers and measurements" practical course laboratory
• Grant detail

... Division of General Nuclear Physics MSU . ... INP MSU . ... Faculty of Physics MSU . ... The ANTARES project is the largest project on registration astrophysical neutrino by detection of cherenkov radiation from secondary particles, arising by neutrino interaction with substance of the Earth. ... Since June, 2009 the group of the Lomonosov Moscow State University takes part in the project. ... Our group consists of young researchers of MSU Skobeltsyn Nuclear Physics Institute and Faculty of Physics....

Еще в разделе: (Показать все результаты (>23) - antares.sinp.msu.ru/ )

• ANTARES в МГУ

Lomonosov project . ... Mikhail Lomonosov . ... The studies of Lomonosov determined profile of Russian science forever, and we appreciate the discoveries of the leading Russian scientists as the studies of his direct learners and successors. A recognized and the most significant input of Lomonosov into natural science is molecular-kinetic theory of heat, developed during the prevalence of theory of specific fiery matter ? ... Lomonosov?s theory drawn wide response in European science. ... Aurora. ...

Еще в разделе: (Показать все результаты (>22) - lomonosov.sinp.msu.ru/ )

• Scientific goals | Университетский спутник "Ломоносов"
• Scientific equipment | Университетский спутник "Ломоносов"
• Magnetospheric particles and radiation conditions | Университетский спутник

... info@ecfs.msu.ru . ... Topic 2: Barriers to Sustainable Soil.. ... We are inviting you to participate in our consultation on "Barriers to Sustainable Soil Management in Eurasia and possible ways for overcoming them".  ... Is workforce capacity in the Eurasian region sufficient for adopting sustainable soil management practices? ... Мы приглашаем вас принять участие в нашей консультации "Барьеры на пути к устойчивому землепользованию в Евразии и возможные пути их преодоления".  ... Topic 2 . ...

Еще в разделе: (Показать все результаты (>13) - ecfs.msu.ru/ )

• Online Consultation on Network and Partnerships in the area of Food Security |

... One can compare the positions of these singularities and their corresponding singular variables in the Feynman diagrams which contribute to the signal process under consideration, and to both reducible and irreducible backgrounds. ... For a standard analysis using cuts on variables, one should cut hard against the regions of singularities in the background singular variables while keeping the regions with singularities for the signal singular variables (see e.g. [8]). ...

Еще в разделе: (Показать все результаты (>9) - top.sinp.msu.ru/ )

THE RUSSIAN STYLE OF CIVIL PROCEDURE Dmitry Maleshin Reprinted from Emory International Law Review Volume 21, No. ... 26 See id. ... Another exceptional feature of the Russian civil procedure is the original status of judicial precedent as a source of Russian civil procedural law. ... 98 See OSCAR G. CHASE, LAW , CULTURE, AND RITUAL: DISPUTING SYSTEMS IN CROSS-CULTURAL CONTEXT 53-55 (2005); JAMES ET AL., supra note 6, at 309-10; THOMAS MAIN, GLOBAL ISSUES IN CIVIL PROCEDURE 5 (2006); Oscar G. Chase. ...

Еще в разделе: (Показать все результаты (>7) - www.law.msu.ru/ )