... We consider now change-points in different components of the frequency spectrum of typical EEG signal. ... Only few change-points in power are found in the initial EEG (unless a prominent alpha rhythm is present). ... Change-points in different frequency components of the EEG . ... Change-points in different types of the EEG alpha activity without substantial gradual changes . ... As can be seen from Fig. 7.3, the program reliably detected the change-points despite of such variety of signal patterns...

Еще в разделе: (Показать все результаты (>49) - brain.bio.msu.ru/ )

• Change-points at different levels of the hierarchy of EEG segmental...
• Analysis of change-point synchronization in multi-channel EEG
• Change-points in multi-channel EEG

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>1014) - monkey.belozersky.msu.ru/ )

• Index of /npidb/pdb/pdb_new
• About COGs
• Example of supporting positions

... Font: Times New Roman . ... size - А4 (21 cm х 29,7 cm) . ... Title should be typed in capital letters, Times New Roman, size 13, boldface font; formatting: center. ... The title and the number of the table should be center-formatted (Times New Roman, size 11, single-spaced, no period/full stop at the end of the title). ... The title under the illustration should be center-formatted (Times New Roman, size 11, single-spaced, no period/full stop at the end of the title). ... Use Times New Roman size...

Еще в разделе: (Показать все результаты (>59) - www.spa.msu.ru/ )

... X-Com key features (2) Ї Lightweight portable toolkit: ґ easy to install Ї Perl-based software Ї doesn't need administrator/root access ... must be written ґ simultaneous work of different platforms Ї joining Windows and Linux machines ґ distributed freely Ї BSD license X-Com basic requirements Ї Linux / Windows Ї Perl 5.8.0+ ґ for Windows: Ї Strawberry Perl (preferred) Ї ActivePerl Ї Open TCP port for Task initializing on server side Server part of the application 2. ... Portion request 6. ...

Еще в разделе: (Показать все результаты (>27) - hpc.msu.ru/ )

• MSU's HPC HISTORY | Moscow University Supercomputing Center

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>8) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/bmc_genom2_2013.pdf

... Cleo batch system is purposed to control parallel tasks on computer clusters. It controls one or more task queues. tasks sceduling (all MPI implemetations are supported, most other parallel environments are supported too) . ... controllable user limits (max used cpus, task work time, etc.) . ... Any task in main will be queued to daughter queues if there aren't enough free own cpus (not shared with daughters). When daughter queues will get enough cpus for this task, it will be runned in main . ...

Еще в разделе: (Показать все результаты (>2) - parcon.parallel.ru/ )

... Keywords: mass media, media industry, media psychology, media audience, homo mediatis Having become an essential part of the modern economy in the postindustrial world, the media have inevitably also become one of the most profitable and powerful industries.Their political, social, and cultural nature is directly influenced by entrepreneurial activity and the market laws of supply and demand (Albarran, 2010). ... Modern people "check" a considerable portion of their political decisions with the...

Еще в разделе: (Показать все результаты (>131) - www.psy.msu.ru/ )

• http://www.psy.msu.ru/science/psyrussia/2013/frolova.pdf
• http://www.psy.msu.ru/science/psyrussia/2009/asmolov.pdf
• http://www.psy.msu.ru/science/psyrussia/2009/podolskij.pdf

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>13) - mouse.genebee.msu.ru/ )

• ConClus
• Nhunt: program for nucleic acid sequence similarity search
• Nhunt

... When embedded within a base document, a URL in its absolute form may contain a great deal of information which is already known from the context of that base document's retrieval, including the scheme, network location, and parts of the url-path. ... Introduction This document describes the syntax and semantics for "relative" Uniform Resource Locators (relative URLs): a compact representation of the location of a resource relative to an absolute base URL. ... 3.1) Base URL embedded in the | ...

Еще в разделе: (Показать все результаты (>4) - hea-www.harvard.edu/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc2396.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1945.txt

... Ярмарка вакансий и стажировок для студентов и выпускников вузов . Новости науки и техники События . ... Подписаться на новости . ... Computer Science . ... Software engineering for mobile devices . ... Design and development of middleware (collaboration system, context-aware system, content system) on mobile devices . Design and development of applications on mobile devices . ... 2) Embedded OS porting, system programming, Mobile OS . ... 5) Location-based service on mobile devices . ...

Еще в разделе: (Показать все результаты (>75) - www.physcareer.ru/ )

• Software Engineer (Server) / Вакансии / Physcareer.ru
• Разработчик-аналитик базы данных (Access) / Вакансии / Physcareer.ru
• Software Engineer (Backend Servers / Web / WAP / Вакансии / Physcareer.ru

... 4; mso-font-charset:204; mso-generic-font-family:swiss; mso-font-pitch:variable; mso-font-signature:536871559 0 0 0 415 0;} /* Style Definitions */ p.MsoNormal, li.MsoNormal, div.MsoNormal {mso- style -parent: ; margin:0cm; margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:12.0pt; font-family: Times New ...

Еще в разделе: (Показать все результаты (>82) - sai.msu.ru/ )

• http://www.sai.msu.ru/internal/library/ieee_tutorial.doc
• А С Т Р О К У Р Ь Е Р
• Index of /groups/cluster/gcvs/gcvs/nsv

... 2015-10-12 20:52 . ... 2011-06-20 18:05 . ... 2012-10-26 17:42 . ... Apache/2.4.10 (Debian) Server at monkey.belozersky.msu.su Port 80 ...

Еще в разделе: (Показать все результаты (>187) - monkey.belozersky.msu.su/ )

• Index of /npidb/scripts
• Index of /npidb/pdb
• Index of /npidb/pdb/html_scop

... 2015-10-12 20:52 . ... 2011-06-20 18:05 . ... 2012-09-12 15:56 . ... Apache/2.4.10 (Debian) Server at npidb.belozersky.msu.ru Port 80 ...

Еще в разделе: (Показать все результаты (>87) - npidb.belozersky.msu.ru/ )

• Index of /data
• Index of /data/html_scop
• Index of /data/samples