... Seminar archive . ... Type Ia Supernovae (SNe Ia) have an important role to measure a distance to an anonymous galaxy because they have a good correlation of the decline rates of the light curves with the absolute luminosity. ... First, super-Chandrasekhar SNe which have extremely high luminosity, slow decline rate of the light curves, slow expansion velocity and strong carbon features. ... As another example of diversity of SNe Ia, I would like also to introduce Type Iax SNe. ... All seminars: . ...

Еще в разделе: (Показать все результаты (>23) - master.sai.msu.ru/ )

• YaB-100 - Biography
• SAI Space Monitoring Laboratory

... It is shown that, independently of preparation conditions, the most stable phases in the samples are single phase SrTi1­ xNixO3 solid solution and NiTiO3 which can coexist. ... This means that among two possible phases, NiTiO3 and NiO, the NiTiO3 phase is precipitated in our sample. ... In the sample with a nominal composi tion of Sr0.98Ni0.02TiO3 annealed at 1500°C, in which nickel is in the NiTiO3 phase, the Ni charge state is identical to its charge state in NiO and NiTiO3 and is 2+. ...

Еще в разделе: (Показать все результаты (>56) - scon155.phys.msu.su/ )

• http://semiconductors.phys.msu.ru/publ/JAdvDielectrics_3_1350031.pdf
• http://semiconductors.phys.msu.ru/publ/PhysSolidState_49_1132.pdf
• http://semiconductors.phys.msu.ru/publ/PhysSolidState_54_1663.pdf

... 6, February, 2015 POLYNUMBERS, NORMS, METRICS, AND POLYINGLES R. R. Aidagulov and M. V. Shamolin UDC 517.925 CONTENTS 1. Vector Spaces and Algebras of 2. Polylinear Functions and Metr 3. ... Groups of coordinate transformations act on functions of vectors (elements of the algebra). ... For bingles, we use a trigonometric function (or, in the case of a pseudo-Euclidean metric, a hyp erb olic function), since the rotation group that changes the value of a bingle is known. ...

Еще в разделе: (Показать все результаты (>37) - shamolin2.imec.msu.ru/ )

• http://shamolin2.imec.msu.ru/art-167-1.pdf
• http://shamolin2.imec.msu.ru/art-133-1.pdf
• http://shamolin2.imec.msu.ru/art-166-1.pdf

PHYSICAL REVIEW B 82, 193402 2010 Full PoincarИ sphere coverage with plasmonic nanoslit metamaterials at Fano resonance M. R. Shcherbakov,1 M. I. Dobynde,1 T. V. Dolgova,1 D.-P. Tsai,2,3 and A. A. Fedyanin1,* 1Faculty of Physics, Lomonosov Moscow State University, Moscow 119991, Russia of Physics, National Taiwan University, Taipei 10617, Taiwan 3Research Center for Applied Sciences ... Figure 1 b shows the map of the output polarization states put onto the surface of the PoincarИ sphere. ...

Еще в разделе: (Показать все результаты (>63) - nanolab.phys.msu.ru/ )

• http://nanolab.phys.msu.ru/sites/default/files/2013chapter.pdf
• http://nanolab.phys.msu.ru/sites/default/files/jap113_17a946_2013.pdf
• http://nanolab.phys.msu.ru/sites/default/files/pre80_046602_2009.pdf

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>15) - mouse.genebee.msu.ru/ )

• ConClus
• Nhunt: program for nucleic acid sequence similarity search
• Nhunt

This document contains frames

Еще в разделе: (Показать все результаты (>32) - shg.phys.msu.ru/ )

Electron and proton impact ionization of atoms and molecules . Theory of few-body Coulomb scattering This is one of the major topics in the research activity of our laboratory. ... Electron momentum spectroscopy (EMS) EMS is the (e,2e) method involving high incident energy and large momentum transfer. ... We develop a theory of the single- and double-ionization EMS processes in atomic and molecular systems. ... c) Laboratory of mathematical models of quantum scattering processes, 2012 . ...

Еще в разделе: (Показать все результаты (>7) - lmmqsp.sinp.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>12) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/mol_biol_mosk_2006.pdf

... 24, No. 4, pp. 943­962 c 2003 Society for Industrial and Applied Mathematics REDUCTION TO VERSAL DEFORMATIONS OF MATRIX PENCILS AND MATRIX PAIRS WITH APPLICATION TO CONTROL THEORY M. I. GARCґ IA-PLANAS AND A. A. MAILYBAEV Abstract. Matrix pencils under the strict equivalence and matrix pairs under the state feedback equivalence are considered. ... In this paper versal deformations of matrix pencils under the strict equivalence and pairs of matrices under the feedback equivalence are considered. ...

Еще в разделе: (Показать все результаты (>30) - mailybaev.imec.msu.ru/ )

• http://mailybaev.imec.msu.ru/papers/Mailybaev2005.pdf
• http://mailybaev.imec.msu.ru/papers/Mailybaev2003.pdf
• http://mailybaev.imec.msu.ru/papers/MailybaevEtAl2004.pdf

... Many of these planetesimals had metallic iron cores and during growth of the Earth this metal re-equilibrated with the Earth's silicate mantle, extracting siderophile (`iron-loving') elements into the Earth's iron-rich core. ... Chemical signature of core formation Growth of the Earth from planetary embryos and planetesimals resulted in the substantial partitioning of siderophile elements into the metallic core, leaving lithophile elements behind in the silicate mantle. ... REE, rare-earth elements....

Еще в разделе: (Показать все результаты (>13) - ocean.phys.msu.ru/ )

• http://ocean.phys.msu.ru/courses/geo/lectures-addons/02/2009%20Bromm%20et%20al.%2C%20The%20formation%20of%20the%20first%20stars%20and%20galaxies.pdf
• http://ocean.phys.msu.ru/courses/geo/lectures-addons/12/2004%20Kanamori%2C%20%20Brodsky%20The%20Physics%20of%20Earthquakes.pdf
• http://ocean.phys.msu.ru/courses/stathyd/2005%20Smyth%20et%20al.%2C%20Differential%20diffusion%20in%20breaking%20Kelvin-Helmholtz%20billows.pdf

... Next Routine] [List of Routines] NAME: ADD_HEADER PURPOSE: addition information from FITS-headers MPFS-frames DESCRIPTION: The function computes the total exposure, mean value zenit distance and modified FITS header CALLING SEQUENCE: Result =ADD_HEADER( headers ) CATEGORY: reduction MPFS-data INPUTS: Headers = String array FITS-headers from the MPFS data OUTPUTS: Header = String array containing the header from the FITS file. ... OPTIONAL INPUT KEYWORD PARAMETERS: BEFORE = Keyword string name. ...

Еще в разделе: (Показать все результаты (>48) - sn.sai.msu.ru/ )

... Unemployment of graduates combined with a shortage of highly educated young people is putting the European governments under pressure to act. ... The Bologna Declaration explicitly mentions the lack of competitiveness of European Higher Education institutions. The signatory countries actually explicitly express their goal to "ensure that the European higher education system acquires a world- wide degree of attractiveness equal to [Europe's] extraordinary cultural and scientific traditions". ...

Еще в разделе: (Показать все результаты (>2) - www.edst.msu.ru/ )

... World history of the last century reflected in life stories of autochthonous minorities in the North Chair: Olga Kazakevich, Lomonosov Moscow State University, kazakevich.olga@gmail.com Co-Chair: Svetlana Burkova, Institute of Philology, Russian Academy of Sciences, Siberian branch, burkova_s@mail.ru The texts in the languages of autochthonous minorities of the North linguists ... The ethnic group being so small, the history of the people amounts to a collection of life stories. ...

Еще в разделе: (Показать все результаты (>17) - lcl.srcc.msu.ru/ )

... Data . ... Services . ... Solar energetic particles . ... N -d SW Conditions : Time profiles of the key geomagnetic ( Ap and Dst indices), solar wind (velocity V , density n and temperature T ) and IMF ( B , Bx , By , Bz in GSM) parameters observed in the N day vicinity of the geomagnetic disturbed day. N -d Map of Solar Events : Map of solar surface events occurred within N day vicinity of the moment when the solar wind expansion (which causes the geomagnetic event) started. ... WIND . ...

Еще в разделе: (Показать все результаты (>24) - smdc.sinp.msu.ru/ )

• COSRAD model - Space monitoring data center
• ShielDose2 model - Space monitoring data center
• Space monitoring data center

... Parameters of February: Anomalies or normal Document on Russia 's environmental policy Governmental report On the state of the environment and on environmental protection in the Russian Federation in 2010 Technologies of environmental development A window into the world of the subglacial lake New specially protected natural territories in Russia New legal acts in the field of ... This is a major problem in the environmental field in Russia," noted Sergei Bobylev. ...

Еще в разделе: (Показать все результаты (>57) - eng.geogr.msu.ru/ )

• http://www.eng.geogr.msu.ru/science/newsletter/5_12.pdf
• http://www.eng.geogr.msu.ru/science/newsletter/03_13.pdf
• http://www.eng.geogr.msu.ru/science/newsletter/06_13.pdf

... Interaction classes . ... List of Contact Types: . ... Contact with Major Groove of DNA by helices, loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by strands, loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by any element(s) and Minor Groove by helices, loops . ... Contact with Major Groove of DNA by any element(s) and Minor Groove by loops . ...

Еще в разделе: (Показать все результаты (>4) - npidb.belozersky.msu.ru/ )

• NPIDB: Home

... info@ecfs.msu.ru . ... Home Resources Projects Draft Plan of Action for Eurasian Subregional.. ... On 7-9 September 2011, after long discussion between FAO and the European Commission, the launch of the Global Soil Partnership ( GSP ) took place at the FAO headquarters in Rome. ... The basic document indicates that Global Soil Partnership is based on regional soil partnerships. ... Assign the MSU Eurasian Center for Food Security as the Secretariat of the Eurasian sub-regional soil partnership. ...

Еще в разделе: (Показать все результаты (>23) - ecfs.msu.ru/ )

• Topic 2: Barriers to Sustainable Soil Management in Eurasia / Барьеры на пути к
• Online Consultation on Network and Partnerships in the area of Food Security |
• TAJIKISTAN FY 2011тАУ2015 Multi-Year Strategy | ECFS

... Inorganic Materials Sciences . ... At the same time at the Faculty of Physics and Mathematics of the Moscow University was founded the Inorganic Chemistry Division which was later transformed into a separate Department of Inorganic Chemistry of the MSU Faculty of Chemistry . ... The latter part of this program is successfully realized at both the Deartment and at the Department of Materials Sciences , the new faculty of MSU, which creation was initiated by the department of Inorganic Chemistry. ...

Еще в разделе: (Показать все результаты (>53) - www.inorg.chem.msu.ru/ )

• Ardashnikova E.I.
• Joint Semiconductors Surface Study group
• Inorganic Synthesis Laboratory - Supramolecular and Cluster Compounds

... О факультете . ... Master In Ecology . ... Master (MSc) . ... A Master will be able to successfully deal with conceptual issues and practical problems related to various subflields of ecology and environmental science. ... Enables the students to develop biopolicies to deal with ecological problems caused by environmental pollution, the disruption of the ecological matrix of an area, and biodiversity-endangering factors. ... Lectures . ... Д 501.001.20 - все защиты . ... Биологический факультет МГУ ...

Еще в разделе: (Показать все результаты (>3) - www.bio.msu.ru/ )

Mechmath admission for internetional students . Specialist degree . ... Specialist variants . Master degree . ... Master variants . Doctoral programme . ... You must have a diploma of a higher education to be an entrant to a master program . We have 2 master programmes by ? Mathematics ?, 7 master programmes be ? ... a document of education, an application to it, and their translations . ... 2016 Mechmath admission for internetional students ...

Еще в разделе: (Показать все результаты (>8) - pk.math.msu.ru/ )

• First Education | Mechmath admission for internetional students
• Philosophy Doctor Programme | Mechmath admission for internetional students
• Mechmath admission for internetional students