О факультете . ... Психологи МГУ . ... История факультета . Награды факультета . ... Совет по психологии УМО университетов РФ . ... Правила приема на факультет психологии МГУ . ... Клуб выпускников факультета психологии МГУ . ... The Difficult Way of Social Psychology in Russia . ... Nadezhda M. Lebedeva, Alexander N. Tatarko / p. 102 . ... Psycho-Semantics of the Altered States of Consciousness of Human . ... Факультет психологии Московского государственного университета им. М.В. Ломоносова . ...

Еще в разделе: (Показать все результаты (>189) - www.psy.msu.ru/ )

• Psychology in Russia: State of the Art, Vol. 2, 2009

... In this article, the light propagation in a diffuser with optically soft inclusions is described with the help of the FokkerґPlanck equation, i.e., a transfer equation with a diffusion term in the space of radiation-propagation directions. The coefficient of angle diffusion is calculated using the Mie theory. The equation is solved numerically using the stochastic analog method, and the space and angle distribution of the radiation that passed through the diffuser is calculated. ...

Еще в разделе: (Показать все результаты (>18) - lizard.phys.msu.su/ )

• http://lizard.phys.msu.su/home/science/science.html
• http://lizard.phys.msu.su/home/science/Dmitriev-Ivanov-Xoxlov-09-FPM-Diffuser.pdf

... О Школе . ... ВШБ МГУ - школе . ... Выпуски журнала . Выпуск 1/2009 Выпуск 1/2010 . Выпуск 2/2010 Выпуск 1/2011 Выпуск 2/2011 Выпуск 1/2012 Выпуск 2/2012 Выпуск 1/2/2013 Выпуск 1/2/2014 Рубрики журнала Информация для авторов Общая структура статьи Информация для рецензентов Контакты . ... Менеджмент Выпуски журнала Выпуск 1/2010 . ... Содержание выпуска 1/2010: . ... EFFECTIVE MANAGERS: THE SECRET TO THEIR SUCCESS FROM THE TEAM ROLES PERSPECTIVE . ... Среда бизнеса . ... Выпуск 2/2010 . ...

Еще в разделе: (Показать все результаты (>80) - www.mgubs.ru/ )

• Вестник Московского университета | Высшая школа бизнеса МГУ им. Ломоносова
• Конкурс на лучшее эссе года
• В газете The Northeastern Voice (Northeastern University) вышла статья про

... WORKSHOP "STELLAR ATMOSPHERES" . THE CHEMICAL AND DYNAMIC EVOLUTION OF STARS AND GALAXIES" . ... Chernomorka , Odessa , Ukraine . ... Modeling and interpretation of the stellar spectra of the usual and peculiar stars. Elemental abundances in the stars of different types and populations of the Galaxy. Chemical evolution of the stars and galaxies. ... Andrievsky S.M. (OAO ONU, Odessa, Ukraine) . ... CHEMICAL and DYNAMIC EVOLUTION STARS and GALAXIES" . ... Odessa mailto:astro@paco.odessa.ua . ...

Еще в разделе: (Показать все результаты (>84) - sai.msu.ru/ )

• Astronomical and Astrophysical Transactions

... Елена Фоменко (2 курс). ... Руководитель В. И. Буник, отдел биокинетики НИИ ФХБ им. А.Н.Белозерского МГУ. ... Руководитель А.Г. Евстафьева, отдел химии и биохимии нуклеопротеидов НИИ ФХБ им. А.Н. Белозерского МГУ. ... Руководитель Н.В. Чичкова, лаборатория молекулярной биологии гена отдела химии и биохимии нуклеопротеидов НИИ ФХБ им. А.Н. Белозерского МГУ. ... Руководитель А.Г. Евстафьева, лаборатория молекулярной биологии гена отдела химии и биохимии нуклеопротеидов НИИ ФХБ им. А.Н. Белозерского...

Еще в разделе: (Показать все результаты (>2) - www.fbb.msu.ru/ )

slov@phys.chem.msu.ru 1. ... 2007. ... ArXiv: Cornell University Library, Physics and Society. http:// arxiv.org/list/physics.soc-ph/recent : ??, (), , (), (), Phys. Rev. E, 2009 ., Interdisciplinary Physics: ~ 180 , ~120 ( 2011 ґ 2012) 500 . ... S.N.Dorogovtsev, A.V.Goltsev, J.F.F.Mendes, Critical phenomena in complex networks, ArXiv:0705.0010v6 [cond.-mat.stat-mech] 16Nov 2007 5. ... Twitter' 100 80 60 40 20 0 2007 2008 2009 2010 2011 2012 FuturICT Project: ? ? (D.Helbing, 2011 .): , , . ...

Еще в разделе: (Показать все результаты (>10) - www.soc-phys.chem.msu.ru/ )

• Семинар по социофизике

Tools for monitoring of data exchange in real-time avionics systems V.V. Balashov, V.A. Balakhanov, A.G. Bakhmurov, M.V. Chistolinov, P.E. Shestov, R.L. Smeliansky, N.V. Youshchenko Lomonosov Moscow State University, Dept. of Computational Mathematics and Cybernetics, Laboratory of Computer Systems e-mail: {hbd,baldis,bahmurov,mike,osmin,smel,yoush}@lvk.cs.msu.su Abstract In this paper we present a toolset for monitoring of data exchange through onboard channels of real-time avionics (RTA) systems. ...

Еще в разделе: (Показать все результаты (>17) - lvk.cs.msu.su/ )

• Index of /~bahmurov/course_simulation/2015/

Here are examples of an alignment for input for the program " LCore ". ... 1NK2 (TGTGTCAAGTGGCTGT):A.P/1 (ACAGCCACTTGACACA):B.P/1 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/1 1NK2 (TGTGTCAAGTGGCTGT):A.P/2 (ACAGCCACTTGACACA):B.P/2 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/2 1NK2 (TGTGTCAAGTGGCTGT):A.P/3 (ACAGCCACTTGACACA):B.P/3 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/3 ...

Еще в разделе: (Показать все результаты (>114) - mouse.belozersky.msu.ru/ )

• Index of /npidb/pdb
• wLake program homepage

... 2012. Vaughan, W. Digital Modelling, 2012. ... Heritage, G.L., Large, A.G. Laser scanning for the Environmental Sciences. 2009. ... Ikeuchi, K., Miyakzaki, D. Digitally Archiving Cultural Objects. 2008. ... Digital Human Modelling: Third International Conference, ICDHM 2011, Held at FL, USA, July 9-14 2011.Springer. ... 2010. ...

Еще в разделе: (Показать все результаты (>23) - www.anthropos.msu.ru/ )

• http://www.antropos.msu.ru/vestnic/e2013_4.doc
• http://www.antropos.msu.ru/vestnic/e2013_3.doc

A GENETIC ALGORHYTM FOR OPTIMIZING A NEURAL NETWORK CAPABLE TO LEARN FOR FOOD SEARCHING IN A RADIAL MAZE Budilova E.V., Chepurnova N.E., Chepurnov S.A, Teriokhin A.T. M.V.Lomonosov Moscow State University, Dept. of Biology. ... The upper platform has a hole in the middle and several radially directed tubular canals ("arms") each of which can contain a peace of food and has doors opening only in the centrifugal direction. ... The task of the animal is to visit only those arms which contain food. ...

Еще в разделе: (Показать все результаты (>44) - ecology.genebee.msu.ru/ )

• http://ecology.genebee.msu.ru/3_SOTR/CV_Terekhin_publ/1998_Repair_EvolEcol.pdf
• http://ecology.genebee.msu.ru/3_SOTR/CV_Terekhin_publ/2003_Envir_human_EER.pdf
• Персональные страницы

ERC Starting Grant 2010 Physical Sciences and Engineering HI Country DE FR ES CH FR ES CH IL FR ES FR DE FR IL FR DE FR NL FR UK DE IL FR CH PT NO FR XShape ... Hyrax Middens and Climate Change in Southern Africa during the last 50,000 years Games and Automata for Logic Extensions Panel PE6 PE6 PE9 PE2 PE3 PE5 PE1 PE5 PE1 PE8 PE5 PE7 PE3 PE6 PE6 PE1 PE6 PE6 PE9 PE5 PE3 PE7 ...

Еще в разделе: (Показать все результаты (>29) - ideas.msu.ru/ )

• http://ideas.msu.ru/docs/Evaluation_panels.pdf
• http://ideas.msu.ru/news/19_10_2010/Results_country.pdf

Mechmath admission for internetional students . Specialist degree . ... Master degree . ... Master variants . ... About Faculty . ... Mathematics and Mechanics Faculty was created 1 May 1933 with a recovery of the faculty system in  Lomonosov MSU . ... The faculty prepares high level experts of wide areas of Mathematics, Mechanics and Applying Mathematics , possessing theoretical knowledge and a technique of scientific experiment . ... 2016 Mechmath admission for internetional students ...

Еще в разделе: (Показать все результаты (>6) - pk.math.msu.ru/ )

... Oxidative stress induced in rat brain by a combination of 3-nitropropionic acid and global ischemia. ... Combination of global ischemia induced by 3-vessel occlusion of major arteries supplys rat brain and subsequent 5-day reperfusion with intraperitoneal injection of 3-nitropropionic acid induces vigorous oxidative stress in brain tissues accompanied by evident neurological symptoms in Wistar rats. ...

Еще в разделе: (Показать все результаты (>50) - biochem.bio.msu.ru/ )

• [Search for chaperon-like anticataract drugs, the antiaggregants of lens
• Expression of NMDA receptors in multipotent stromal cells of human adipose
• Human pro-B-type natriuretic peptide is processed in the circulation in a rat

... OLYMPIAD of NSC. This letter contains information about scientific contest - Olympiad, which is held yearly in Chernogolovka: a small pictures- que village not far from Moscow, in which the Noginsk Scientific Center (NSC) of the Russian Academy of sciences is situated. The contest is participated by pupils of the 8-th to the 11-th forms and consists in solving problems in physics, astronomy and mathema- tics. The Olympiad is one of interesting traditions of our scienti- fic centre. ...

Еще в разделе: (Показать все результаты (>17) - www.issp.ac.ru/ )

• Gavrilov M.G. "Zviozdnyj Mir", vol.IV
• II International Astronomy Olympiad, Problems to solve
• IO of EAAS, Problems to solve (In Russian)

Alexandra A. Zobova . NAME: Alexandra A. Zobova . ... AFFILIATION: Associate Position, Department of Theoretical Mechanics and Mechatronics, . Faculty of Mechanics and Mathematics, . Lomonosov Moscow State University . ADDRESS: Alexandra A. Zobova , . ... Moscow State University, 2008 . ... Laboratory Training for the students of the Theoretical Mechanics and Applied Mechanics and Control Departments . Lecture Course on 'Dynamics of the Systems of Solid Bodies with Friction' . ...

Еще в разделе: (Показать все результаты (>5) - www.theormech.math.msu.su/ )

• Кафедра теоретической механики и мехатроники механико-математического

In the first part of the book, a systemic concept of algal diversity is lais out. ... On this basis, a functional model of aquatic ecosystem is worked out and the critical levels of its development are defined. ... Second part of the book is a data base for algal species used as ecological markers (3193 species of algae). ... ALGAL INDICATORS AS ENVIRONMENTAL QUALITY. ... PART I. METHODOLODICAL ASPECTS OF BIOLOGICAL DIVERSITY ANALYSIS OF ALGAE . ... Critical state of aquatic ecosystem (P.39) . ...

Еще в разделе: (Показать все результаты (>192) - herba.msu.ru/ )

• Complete flora of islands and lakes as a statistical hypothesis
• The flower organ transition in water-lily
• Algologia. Vol.7, No. 3

... О факультете . ... Master In Ecology . ... Master (MSc) . ... A Master will be able to successfully deal with conceptual issues and practical problems related to various subflields of ecology and environmental science. ... Enables the students to develop biopolicies to deal with ecological problems caused by environmental pollution, the disruption of the ecological matrix of an area, and biodiversity-endangering factors. ... Lectures . ... Д 501.001.20 - все защиты . ... Биологический факультет МГУ ...

Еще в разделе: (Показать все результаты (>9) - www.bio.msu.ru/ )

• Master In Nanobiotechnology ? Биологический факультет МГУ
• Cеминар "Scientific Writing in English. Problems in writing up research: How to

Кафедра высокопроизводительных вычислений МГУ . Главная . ... Главной задачей кафедры является организация и осуществление на высоком уровне учебно-воспитательной работы по подготовке специалистов высокой профессиональной квалификации по высокопроизводительным вычислениям на многопроцессорных ЭВМ из числа студентов 2-5 курсов механико-математического факультета , физического факультета , факультета вычислительной математики и кибернетики, химического факультета и других факультетов ...