... Surface disturbance and deformat ion are shown in the same scale. Displac the free surface is much smoother as compared bottom deformations: init ial elevat ion has amplitude and spreads over a rather wide area. bottom theory, bottom ement of with the smaller F ­ velocity potential, H ­ depth, ­ vector of bottom deformation, 0 ­ initial elevation a . ... The init ial elevation assumed to be equal to the vertical bottom deformat ion (a); calculated with use of the Laplace smoothing algorithm (b). ...

Еще в разделе: (Показать все результаты (>12) - ocean.phys.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>12) - storage.bioinf.fbb.msu.ru/ )

ISSN 1560-3547, Regular and Chaotic Dynamics, 2015, Vol. ... Spherical Rob ot of Combined Typ e: Dynamics and Control Alexander A. Kilin1* , Elena N. Pivovarova1** , and Tatyana B. Ivanova2 2 *** Udmurt State University, ul. ... In [15], the dynamics and control of the motion of a spherical rob ot with an internal omniwheel platform is discussed. ... REGULAR AND CHAOTIC DYNAMICS Vol. ... DYNAMICS OF THE FREE SYSTEM Consider the dynamics of the free motion of the spherical rob ot. ... Monogr., vol. ...

Еще в разделе: (Показать все результаты (>131) - ics.org.ru/ )

• http://ics.org.ru/upload/iblock/268/pu_58_1220.pdf
• http://ics.org.ru/upload/iblock/0cd/RCD232.pdf
• http://ics.org.ru/upload/iblock/b7b/RCD190101.pdf

... Notice: Undefined index: outp in /home/swx/public_html/models/database/modules/db2.php on line 69 Notice: Undefined index: failo in /home/swx/public_html/models/database/modules/db2.php on line 70 Notice: Undefined index: elems in /home/swx/public_html/models/database/modules/db2.php on line 71 Notice: Undefined index: events in /home/swx/public_html/models/database/modules/db2.php on line 72 . ...

Еще в разделе: (Показать все результаты (>1239) - swx.sinp.msu.ru/ )

• SWX - Космическая погода

The laboratory is engaged in fabricating high-efficiency catalysts and working out theoretical descriptions of kinetics and mechanisms of the processes which takes place in chemical power sources. ... The kinetics of electrooxidation of some simplest organic fuels is investigated, which is of interest for electrochemical generators. ... B.I.Podlovchenko, E.A.Kolyadko, Lu Shigan, Specific Features of Hydrogen Sorption by Pd Dispersed Forms at a-Phase Potentials // J.Electroanal. ...

Еще в разделе: (Показать все результаты (>18) - www.elch.chem.msu.ru/ )

• Laboratory of Electrocatalysis and corrosion

Lomonosov Moscow State University, Faculty of Mechanics and Mathematics, English Department Mathematics and the Arts: Title of theses, Times New Roman 14 pt by D. Crystal, group 227, your email: Times New Roman 14pt; 1,5 linespace English teacher: D. Jones 1. ... Times New Roman, 14pt; 1,5 linespace. ... English teacher: __________________/ D. Jones ...

Еще в разделе: (Показать все результаты (>26) - www.eng.math.msu.su/ )

• http://www.eng.math.msu.su/download/Margaret_Thatcher_article_and_vocabulary.pdf
• http://www.eng.math.msu.su/download/Academic_English_part1.pdf
• http://www.eng.math.msu.su/download/dictionary.pdf

Главная Международные связи Иностранным студентам/ Incoming students . ... Semester Dates for International Students: . ... In case of institutional agreement on international student exchange the program is free of charge. ... All students should come to Russia by Moscow State University invitation. ... Students enter Russia with a single-entry visa. ... Exams/Passes . ... Pass . ...

Еще в разделе: (Показать все результаты (>61) - www.mgubs.ru/ )

• Выпуск 2/2011 | Высшая школа бизнеса МГУ им. Ломоносова
• Выставка "Образование для взрослых"

... Paradigm shifts by Kuhn: successive change of one model by another, rather than integration of different paradigms Progress of science: from single- to multi-model approach Some examples from natural science... · theory of light: from vibration of ether to wave-particle duality · laws of motion: from Newton's dynamics to SchrЖdinger 's and Heisenberg's formalism In social and environmental sciences appreciation of the multi-model ...

Еще в разделе: (Показать все результаты (>5) - oc.cs.msu.ru/ )

... PhDi . ... SOFTWARE PACKAGE FOR CALCULATIONS OF PHASE DIAGRAMS . elaborated and developed by laboratory scientists) . The software package contains a database of thermodynamic properties for about 200 systems and a software based on a so called convex hulls approach. ... binary systems in coordinates Temperature - Composition at fixed pressure and Pressure ? ... Colloquium on 24.12.12 20 Dec 2012 . ... Colloquium on 23.11.12 22 Nov 2012 . ... Laboratory of Chemical Thermodynamics . ...

Еще в разделе: (Показать все результаты (>11) - td.chem.msu.ru/ )

• Publications Laboratory of Chemical Thermodynamics

... All Authors Title Abstract Index terms Full Text . ... Home > ICONO/LAT 2016 > 2014 International Conference on Laser Applications in Life Sciences > About the Conference > Submissions . ... All URL addresses in the text (e.g., http://pkp.sfu.ca ) are activated and ready to click. ... If submitting to a peer-reviewed track of the conference, authors' names are removed from submission, with "Author" and year used in the bibliography and footnotes, instead of authors' name, paper title, etc. ...

Еще в разделе: (Показать все результаты (>49) - hea.phys.msu.su/ )

• Search
• Notification mailing list

... Heterooligomeric complexes of human small heat shock proteins. ... Oligomeric association of human small heat shock proteins HspB1, HspB5, HspB6 and HspB8 was analyzed by means of size-exclusion chromatography, analytical ultracentrifugation and chemical cross-linking. Wild-type HspB1 and Cys mutants of HspB5, HspB6 and HspB8 containing a single Cys residue in position homologous to that of Cys137 of human HspB1 were able to generate heterodimers cross-linked by disulfide bond. ...

Еще в разделе: (Показать все результаты (>90) - biochem.bio.msu.ru/ )

• Utilization of fluorescent chimeras for investigation of heterooligomeric
• Кафедра биохимии биологического факультета МГУ - официальный сайт | 404 -
• Heterooligomeric complexes formed by human small heat shock proteins HspB1

... A.A. Berezhnoi, Sternberg Astronomical Institute, Moscow, Russia . Resume. ... S.G.Pugacheva, V.V.Shevchenko, Sternberg State Astronomical Institute, Moscow University, Moscow, Russia . ... J.F.Rodionova, Sternberg State Astronomical Institute Moscow University, Moscow, Russia . ... V.V.Shevchenko, Sternberg State Astronomical Institute, Moscow University, Moscow, Russia . ... 2 Sternberg State Astronomical Institute, Moscow University, Moscow, Russia, . ... Sternberg State Astronomical Institute. ...

Еще в разделе: (Показать все результаты (>97) - selena.sai.msu.ru/ )

• Бережной А.А.
• Aleksei A. Berezhnoi

... The national strategic management system in Russian power industry is far from perfect and is in the process of its formation after a long period of radical reform in the industry. ... This article s goal is to offer a more adaptable conceptual model for national strategic management in a branch of economy (on the example of the electric power industry). ... National strategic management, power industry, conceptual model, level of environmental uncertainty. ... Public Administrarion". ...

Еще в разделе: (Показать все результаты (>203) - ee-journal.spa.msu.ru/ )

The Nine Planets is best viewed on-line via a graphical WWW browser which displays the pictures in color and supports hypertext link traversal. ... To view the movies and hear the sounds, you'll need additional helper programs. ... I recommend that you use Netscape as your browser. Netscape can display gif and jpeg images directly without need of any additional helper apps. You do need additional helper apps for movies and sounds, however. ... Yahoo's Helper Applications .. ... Tech Help .. ...

Еще в разделе: (Показать все результаты (>2) - www.iki.rssi.ru/ )

Journal of Mammalogy, 87(4):643­662, 2006 SPECIATION IN MAMMALS AND THE GENETIC SPECIES CONCEPT R OBERT J. B AKER* AND R OBERT D. B RADLEY Department of Biological Sciences and the Museum, Texas Tech University, Lubbock, TX 79409-3131, USA We define a genetic species as a group of genetically compatible interbreeding natural populations that is genetically isolated from other such groups. This focus on genetic isolation rather than reproductive isolation distinguishes the Genetic Species Concept from the

Еще в разделе: (Показать все результаты (>63) - vertebrata.bio.msu.ru/ )

• Student Reports at International Conferences
• Выступления студентов и аспирантов на конференциях

... The kinetics of the ESR signal from P700 (ESR signal I) was recorded at different concentrations of exogenous ferredoxin, ,A kinetic model was developed for ferredoxin-dependent cyclic electron transport around photosystem I. A multiparticle model was built to directly describe electron transfer in multienzyme complexes and restricted diffusion of mobile carriers in individual compartments (stroma, lumen, intramembrane space) of the system. ... Ferredoxin Lumen Photosystem I Plastocyanin Fig. ...

Еще в разделе: (Показать все результаты (>36) - library.biophys.msu.ru/ )

• http://library.biophys.msu.ru/PDF/3329.pdf
• http://library.biophys.msu.ru/PDF/3344.pdf
• http://library.biophys.msu.ru/PDF/3340.pdf

Tools for monitoring of data exchange in real-time avionics systems V.V. Balashov, V.A. Balakhanov, A.G. Bakhmurov, M.V. Chistolinov, P.E. Shestov, R.L. Smeliansky, N.V. Youshchenko Lomonosov Moscow State University, Dept. of Computational Mathematics and Cybernetics, Laboratory of Computer Systems e-mail: {hbd,baldis,bahmurov,mike,osmin,smel,yoush}@lvk.cs.msu.su Abstract In this paper we present a toolset for monitoring of data exchange through onboard channels of real-time avionics (RTA) systems. ...

Еще в разделе: (Показать все результаты (>9) - lvk.cs.msu.su/ )

• http://lvk.cs.msu.su/~bahmurov/course_advanced_networks/ITU_OTN_Tutorial.pdf

... A new environmental -economic policy Low environmental financing Boris Gryzlov: the ruling party on environmental problems Sociological survey of the state of environment in Russia The outcome of Rosprirodnadzor in 2010 Environmental policy in the Northwest Federal District Fundamentals of Ecological Policy of ... Environmental policy in the Northwest Federal District Heads of territorial bodies of Rosprirodnadzor in the Northwest Federal District summed up for 2010. ...

Еще в разделе: (Показать все результаты (>289) - www.geogr.msu.ru/ )

• CONTENTS ?5 - 2010
• CONTENTS ?1 - 2010
• CONTENTS ?3 - 2009

Chair of General Physics and Wave Processes, Physics Faculty of MSU . ... Main Science and education Scientific Laboratories Laboratory of nonlinear polarization optics . ... The mechanisms of evolution of polarization during radiation propagation in nonlinear media with nonlocality of optical response. ... As a result, a new field of science has originated, the nonlinear polarization optics, providing new insights into the interplay of polarization effects in classic nonlinear optical processes. ...

Еще в разделе: (Показать все результаты (>136) - ofvp.phys.msu.ru/ )

• International conference on Advanced Laser Technologies ALT'12

ERROR: Please enter a valid OpenID.