Space Weather . ... Space weather . ... Data . ... You should fill in "Workspace" by groups of data sets to create plots. ... Putting different kind of data into the same plot remember, that the first dropped data set chooses and determines the axis scale for all data. ... If you need both kind of scale in the same plot, create two different plots and unite them. The speed of this service depends on 3 components: data processing on server, data transmission and data plotting in your browser. ...

Еще в разделе: (Показать все результаты (>1227) - swx.sinp.msu.ru/ )

SELECT data_key, data_value FROM xf_data_registry WHERE data_key IN ('options', 'languages', 'contentTypes', 'codeEventListeners', 'cron', 'simpleCache', 'routesPublic', 'bannedIps', 'styles', 'nodeTypes', 'smilies', 'bbCode', 'displayStyles', 'trophyUserTitles', 'reportCounts', 'moderationCounts') . Run Time: 0.000535 . Select Type . ... Type . ... SIMPLE . ... PRIMARY . ... const . ... library/XenForo/ Autoloader.php . ... library/Zend/Registry.php . ... library/Zend/Db/Select.php . ...

Еще в разделе: (Показать все результаты (>26) - osk.msu.ru/ )

• http://osk.msu.ru/forum/members/aaplicagf.1452/?_debug=1
• http://osk.msu.ru/forum/members/adollekautoto.2142/?_debug=1
• http://osk.msu.ru/forum/members/arbimeorirm.2192/?_debug=1

Make a difference faster. ... Morgan Stanley, a global leader, can make you part of the financial markets, techniques and transactions that help shape the world we live in. ... Thursday, October 25, 2007 16:30 Lomonosov Moscow State University (MSU) Auditorium -5 of the 2nd Humanitarian building FOR FURTHER DETAILS, PLEASE VISIT WWW.MORGANSTANLEY.COM / CAREERS / RECRUITING Morgan Stanley is an equal opportunity/affirmative action employer committed to workforce diversity. ...

Еще в разделе: (Показать все результаты (>58) - www.msu.ru/ )

• http://www.msu.ru/work/2010/sec-vac.pdf
• http://www.msu.ru/science/details/2010/101021-moscow-wp2011.pdf
• http://www.msu.ru/science/details/2010/101021-moscow-how.pdf

... The philosophical consequences of synergetics, the interdisciplinary theory of evolution and self-organization of complex systems, are being drawn in the paper. ... Key words: complex systems, evolution, nonlinearity, pre-determination, self-organization, soft management, structure-attractors, synergetics 1. ... The spectra of possible, `allowed' structures correspond to sets of the eigenfunctions of the nonlinear equations describing the evolutionary processes in the complex system. ...

Еще в разделе: (Показать все результаты (>8) - www.students.chemport.ru/ )

• тест ?4 по английскому языку

... 7.1] Lectures of prof. Scrucca in Advanced quantum field theory (e.g., for the first study of the worldline formalism): http://itp.epfl.ch/webdav/site/itp/users/181759/public/aqft.pdf . ... I. Topological quantum effects Lecture 1 (Spring 2015) , The Outline Before Casimir: the van der Waals forces (presentation, pdf) . ... Lecture 5 (Fall 2015) , Lattice field theory: 'free fields' (presentation, pdf) . Lectures 6-7 (Fall 2015) , Lattice field theory: 'interacting fields'. ...

Еще в разделе: (Показать все результаты (>5) - theorphys.phys.msu.ru/ )

... Rapid developments of lasers and particle accelerators resulted in implementation of laser plasma X-ray sources and free electron lasers for various experiments requiring high intensity, shrt duration and monochromatic X-ray radiation. ... BASICS AND APPROACH Thirty years development of laboratory X-ray lasers allowed to reach ~0.1 keV photon energy of coherent X-ray beams in a repetitive mode. ... X-rays originate from Thomson scattering of counter propagating laser and electron beams. ...

Еще в разделе: (Показать все результаты (>7) - miles.sinp.msu.ru/ )

... A direct current with a surface density of jmax ~ 103 A/cm2 violates the symmetry of the electron distribution function and induces the optical second harmonic with an intensity corresponding to the dipole quadratic susceptibility (2)d( jmax) ~ 3 в 10­15 m/V. PACS numbers: 7.57.Lm, 76.60.-k DOI: 10.1134/S0021364009020027 The surface nonlinear optics of centrosymmetric media is a rapidly developing line in diagnostic nonlinear optics. ...

Еще в разделе: (Показать все результаты (>62) - nanolab.phys.msu.ru/ )

• http://nanolab.phys.msu.ru/sites/default/files/nl503029j3.pdf
• http://nanolab.phys.msu.ru/sites/default/files/ol40_1571_2015.pdf
• http://nanolab.phys.msu.ru/sites/default/files/jetplett101_787_2015.pdf

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/jbcb_2006.pdf
• http://storage.bioinf.fbb.msu.ru/~lan787/

M obile A stronomical Sy stem of TE lescope- R obots MASTER-II Kislovodsk Lomonosov Moscow State University, Sternberg Astronomical Institute , Moscow Union "Optic" , Kislovodsk Solar Station Latitude = 43 o љ44'.767љN; Longitude = 42 o љ31'.417љE; Altitude = 2067љm MASTERљIIљ(8љsquareљdegress) + MASTERљVWF(VeryљWideљFieldљCameras (FOV=800 square degrees, Timeљresolutionљupљtoљ150љms, with unfiltered m_lim=14m on 5 sec. exposure, and ~10.5m with 0.15 sec) . ... 11h 38m 38.0s , -09d 59m 59s) . ...

Еще в разделе: (Показать все результаты (>2) - apollo.sai.msu.ru/ )

• Meteo :: Kislovodsk Database ::

Les Иtudiants Иtrangers Ю la facultИ de la Politique Internationale. La facultИ de la Politique Internationale offre aux Иtudiants Иtrangers (du proche Иtranger et de l'Иtranger lointain) la formation dans le domaine des relations internationales - 41.03.05 - « Les Relations Internationales». ... En dehors des cours magistraux ils apprennents la langue russe et ils font leur connaissance de la culture et de l'histoire de la Russie. ... L'original de l'annexe du document sur la formation 4. ...

Еще в разделе: (Показать все результаты (>2) - fmp.msu.ru/ )

... Paradigm shifts by Kuhn: successive change of one model by another, rather than integration of different paradigms Progress of science: from single- to multi-model approach Some examples from natural science... · theory of light: from vibration of ether to wave-particle duality · laws of motion: from Newton's dynamics to SchrЖdinger 's and Heisenberg's formalism In social and environmental sciences appreciation of the multi-model ...

Еще в разделе: (Показать все результаты (>8) - oc.cs.msu.ru/ )

• CURRICULUM VITAE

Analysis of the ANTARES data for SN neutrino detection V. Kulikovskiy (MSU / INFN Genova) Hit counts in the detector. The number of hits ( hit counts ) in a time slice (104.8 ms) is used (this information is stored in each run) Mean number of hit counts in one PMT is ~5500 (corresponds to ~55 kHz) Expected number of hits from SN in 100ms is 11.6 ( 550 0) Bioluminescence bursts should be excluded Bioluminescence cut We have collected distributions of hit counts for each ...

Еще в разделе: (Показать все результаты (>27) - antares.sinp.msu.ru/ )

• http://antares.sinp.msu.ru/docs/MAM%202011%20-%20Yaroslav.pdf
• http://antares.sinp.msu.ru/docs/NIMA.pdf
• http://antares.sinp.msu.ru/docs/Shirokov%20-%20The%20first%20results%20of%20MSU%20groups%20in%20ANTARES%20project.pdf

The Nine Planets is best viewed on-line via a graphical WWW browser which displays the pictures in color and supports hypertext link traversal. ... To view the movies and hear the sounds, you'll need additional helper programs. ... I recommend that you use Netscape as your browser. Netscape can display gif and jpeg images directly without need of any additional helper apps. You do need additional helper apps for movies and sounds, however. ... Yahoo's Helper Applications .. ... Tech Help .. ...

Еще в разделе: (Показать все результаты (>2) - www.iki.rssi.ru/ )

• The Origin of the Solar System

... Emerging evidence for a similar role of glutamate receptors in the nervous and immune systems. ... The role of glutamate receptors in synaptic transmission and excitotoxicity in the nervous system is well established. ... We conclude that glutamate is involved in signaling in immunocompetent cells and that the expression of both ionotropic and metabotropic glutamate receptors may have regulatory functions in immunocompetent cells, as well as in the nervous system. ...

Еще в разделе: (Показать все результаты (>35) - biochem.bio.msu.ru/ )

• Generation of recombinant antibodies and means for increasing their affinity.
• Chaperone-like activity of monomeric human 14-3-3zeta on different protein

... Letter of Application . ... Minilecture: How to organise information in the letter of application. When one applies for a position in a company, the letter of application cannot and should not contain all the information a prospective employer wants to know about you. ... If you know about a job opening within the company, refer directly to that position; if some person from that company told you of the job opening, you may begin the first paragraph by mentioning this person by name. ...

Еще в разделе: (Показать все результаты (>12) - anazarenko.ffl.msu.ru/ )

• Методика обучения иностранным языкам

Please enter the lightcurve file name and period search parameters: . Lightcurve file: . ... Apply the Heliocentric correction and convert all dates to Terrestrial Time (TT)? ... Also, the Heliocentric correction cannot be applied to such lightcurves. ... This period search service is also available at the mirror sites: Mirror 1 , Mirror 2 , Mirror 3 , Mirror 4 . You may download the latest source code distribution and install the period search service at your own web server. ...

Еще в разделе: (Показать все результаты (>2) - scan.sai.msu.ru/ )

• Index of /lk/source

... Analysis of the Characteristics of Self Similarity of Seismicity and the Active Fault Network of Eurasia V. S. Zakharov Faculty of Geology, Moscow State University, Moscow, 119899 Russia e mail: vszakharov@yandex.ru; zakharov@dynamo.geol.msu.ru Received February 22, 2011 Abstract--An analysis of the possible relationship between fractal dimensions of the active fault network, spatial distribution of earthquake epicenters, and parameter b in the Gutenberg­Richter law is presented. ...

Еще в разделе: (Показать все результаты (>17) - dynamo.geol.msu.ru/ )

• http://dynamo.geol.msu.ru/personal/vsz/papers/Koronovsky_etal_2015_eng.pdf
• http://dynamo.geol.msu.ru/personal/vsz/papers/Zakharov_Simonov_2010_eng.pdf
• http://dynamo.geol.msu.ru/personal/vsz/papers/Zakharov_2013_2_eng.pdf

APPLIED PROBLEMS Identification of Inorganic Salts and Determination of Their Concentrations in Aqueous Solutions Based on the Valence Raman Band of Water Using Artificial Neural Networks S. A. Burikov, T. A. Dolenko, V. V. Fadeev, and A. V. Sugonyaev Physics Faculty, Moscow State University ... .msu.su, tdolenko@radio-msu.net, fadeev@lid.phys.msu.su, sugonjaev@lid.phys.msu.su Abstract--The characteristic features of the valence Raman band of ...

Еще в разделе: (Показать все результаты (>23) - rswater.phys.msu.ru/ )

• http://rswater.phys.msu.ru/en/articles/2013/opt%20mem.pdf
• http://rswater.phys.msu.ru/en/articles/2014/Using.pdf
• http://rswater.phys.msu.ru/en/articles/2014/Kohonen.pdf

... The linguistic aspects of the model and the properties of the semantic dictionary ensuring the content analysis with compression of the text structure are considered. Our dictionary resources serve an instru- ment for building a multilevel textual semantic structure. ... Reason (A,B), where SemF(A) = SIT or a whole semantic formula; the same for SemF(B). ... Sem(SIT)R . ... Semantic Resources for Textual Content Compression // Fourth International Conference on Meaning-Text Theory (MTT'09). ...

Еще в разделе: (Показать все результаты (>4) - leontyeva.srcc.msu.ru/ )

• Semantic Dictionary for Text Understanding and Summarization
• Lexical Resources for Personal Data Recognition in Texts

... This is a bug fix release for the 3.x series of Joomla. ... Project and the Production Leadership Team are proud to announce the release of Joomla! 3.5 as the latest in the 3.x series. ... CMS 3.5 Release Candidate 4 . ... CMS, with 3.5 the sixth standard-term support release in this series. ... That being said, please do not upgrade any of your production sites to the release candidate version as a release candidate is ONLY intended for testing and there is no upgrade path from a Release Candidate....

Еще в разделе: (Показать все результаты (>3) - biophys.phys.msu.ru/ )