... Д. ы. кйбДзйЗ еУТНУ,ТНЛИ ,,УТЫ ТЪ,ВММњИ ЫМЛ,В ТЛЪВЪ ЛП. е.З. гУПУМУТУ, ї кУБМУ, Д.ы., 1999 - . ... кйбДзйЗ Д.ы. лйЗкЦеЦззДь иДгЦйзнйгйЙаь 47 "" ( ). [10]. , ( 650-550 ), - 1,2-1,3 . ... 48 лйкйлйЗлдав йЕкДбйЗДнЦгъзхв ЬмкзДг, <1, 1999 , 0,5 Metazoa 1,0 , ; 1,5 , ; ; 2,0 2,5 3,0 3,5 , 4,0 4,5 . ... кйбДзйЗ Д.ы. лйЗкЦеЦззДь иДгЦйзнйгйЙаь 49 - - , ? ... I - ; II - ; III - , ; IV - ; V - ; VI - - ; VII - - ; VIII - - ; IX - , - , C 3 -- 3 - - T кйбДзйЗ Д.ы. лйЗкЦеЦззДь иДгЦйзнйгйЙаь 51 . ... 1983. ...

Еще в разделе: (Показать все результаты (>164) - www.pereplet.ru/ )

• Super Ratio
• The Avalon Project : Treaty concerning the Cession of the Russian Possessions

... справочник учебные материалы ссылки программы . ... TEST 1 (Text 1, Present Tenses) . I Write synonyms of the following. 1. main . ... 3. принадлежащий химии . ... фотоs учебные материалы : выберите дисциплину неорганическая химия аналитическая химия органическая химия химические основы биологических процессов физическая химия квантовая механика, химия и строение молекул радиохимия кристаллохимия коллоидная химия химия ВМС химическая технология история и методология ...

Еще в разделе: (Показать все результаты (>5) - www.students.chemport.ru/ )

The Early Music Theatre >> Repertoire >> Carmina Profanae . ... It is based on Karl Orff's cantata "Carmina Burana" and songs of 13th-century vagrants. ... The performance includes all the 25 parts of Orff's cantata "Carmina Burana" in Latin, old-Bavarian, and Russian (translations by M. Gasparov and L. Ginsburg) as well as authentic songs of 12-13th-century vagrants from "Carmina Burana" collection: "In taberna quando sumus", "Ecce gratum", "Tempus est iocundum". ...

Еще в разделе: (Показать все результаты (>2) - www.tsm-msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>8) - storage.bioinf.fbb.msu.ru/ )

... We will dwell on linguistic aspects and Lexical Resources of POLITEXT branch having in mind some intermediate semantic representation of a whole text as the basis for differentiated Information Extraction. It is personal data (in the social sphere) recognition in texts that we focus on, see (Leontyeva et al. ... As the main instrument of semantic analysis of coherent texts this dictionary bears the important information on how to build BTF-units starting from lexemes of SemDict entries. ...

Еще в разделе: (Показать все результаты (>4) - leontyeva.srcc.msu.ru/ )

• Semantic Resources for Textual Content Compression

... Ярмарка вакансий и стажировок для студентов и выпускников вузов . Новости науки и техники События . ... Подписаться на новости . Вакансии . ... Ярмарки вакансий и выставки . ... When a customer expresses dissatisfaction with their experience of HP's 'business as usual' process and is looking for HP to both recognize and respond to their concern, Customer Relation Team (CRT) organization handles this . ... d. Remain customer contact point . ... 2009 or 2008 Graduate: mandatory requirement! ...

Еще в разделе: (Показать все результаты (>149) - www.physcareer.ru/ )

• Quality Control Engineer / Tester (Student/Intern) / Вакансии / Physcareer.ru
• Solution Centre Engineer (Graduate) / Вакансии / Physcareer.ru
• Office Manager / Вакансии / Physcareer.ru

... Aptamer DNA : A New Type of Thrombin Inhibitors V. A. Spiridonova*,1 E. V. Rog**, T. N. Dugina***, S. M. Strukova***, and A. M. Kopylov** *Belozersky Institute of Physicochemical ... State University, Vorob'evy gory, Moscow, 119899 Russia Received November 13, 2002; in final form, November 21, 2002 Abstract--The formation of complexes between various thrombin preparations and 30-mer aptamer DNA was comparatively studied, and a correlation between the ... 5 2003 Vol. ... Vol. ...

Еще в разделе: (Показать все результаты (>6) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.su/pdfs/MolBio6_00KopylovLO.pdf
• http://rnp-group.genebee.msu.ru/pages/pdf/biochem2002_1.pdf

PHYSICAL REVIEW A 70, 053801 (2004) Orthogonality of biphoton polarization states M. V. Chekhova, L. A. Krivitsky, S. P. Kulik, and G. A. Maslennikov Department of Physics, Moscow State University, 119992 Moscow, Russia (Received 25 October 2003; published 3 November 2004) Orthogonality of two-photon polarization states belonging to a single frequency and spatial mode is demonstrated experimentally, in a generalization of the well-known anticorrelation "dip" experiment. ... FIG. ...

Еще в разделе: (Показать все результаты (>68) - qi.phys.msu.ru/ )

• http://qi.phys.msu.su/papers/2005-jetp(e)-100-521.pdf
• http://qi.phys.msu.su/papers/2006-jetp(e)-102-712.pdf
• http://qi.phys.msu.ru/papers/2011-pra-84-042108.pdf

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>20) - tukachev.flogiston.ru/ )

• Category: Новости

THE PROBLEM OF COUNABILITY OF HIGHEST ORDINALS . ... The first form corresponds to the geometric representation of ordinal w n as an infinite n -dimensional matrix. According traditional formulation w w = U w i , i =1, w , thus w w is w -countable union of countable ordinals so w w is countable. ... TWO METHODS OF RENUMBERING OF ELEMENTS OF ORDINALS The fist infinite ordinal w designates the set of natural numbers which is countable by definition. ... This matrix represents ordinal w (w ^ w) . ...

Еще в разделе: (Показать все результаты (>7) - www.protein.bio.msu.ru/ )

... Toxic heavy metal pollutants can cause great harm to terrestrial ecosystems. ... The focus of this work will be to link short-term (months) and long-term (years) microbial community dynamics and pollutant tolerance with varying levels of metal (lead) contamination. ... Spatial variability of podzol properties in forest ecosystems under air pollution impact. ... Koptsik, S., Koptsik, G., and Eruslankina, L. Heavy metals in subarctic forest ecosystems: soil pollution and impacts on plant diversity. ...

Еще в разделе: (Показать все результаты (>19) - eco.soil.msu.ru/ )

• Pine Needle Chemistry near a Large Point SO2 Source in Northern Fennoscandia
• Vegetation and soils of National Park “Smolenskoye Poozer'ye”
• ASSESSMENT OF SOIL SUSTAINABILITY TO ACID DEPOSITION

... IN MEMORIAM HASSAN AREF (1950­ 2011 ) Alexey V. Borisov1* , Viatcheslav V. Meleshko2** , Mark Stremler3 *** , and GertJan van Heijst4 **** Institute of Computer Science ... Department of Engineering Science and Mechanics, Virginia Polytechnic Institute and State University, Blacksburg, VA 24061, USA 4 Fluid Dynamics Laboratory, Department of Physics, Eindhoven University of Technology, PO Box 513, 5600 MB Eindhoven, The Netherlands Received Novemb ... 6 2011 HASSAN AREF (1950­2011) 675 Fig....

Еще в разделе: (Показать все результаты (>120) - ics.org.ru/ )

• http://ics.org.ru/upload/iblock/ad1/165-two-non-holonomic-integrable-problems-tracing-back-to-chaplygin_ru.pdf
• Institute of Computer Sciences - Publications

... Tn Pi, i=1..n Di Ci i Di P i · : ­ ­ Rate Monotonic · ­ () · ­ · U n(21/n - 1) U =sum(Ui), Ui = Ci/Pi; EDF (Earliest Deadline First) · = · : U 1 : : 10 / 30 ; B: 15/40; C: 5/50 : (2) A: 15 / 40 EDF () · · · · mq_open() // const char* mq_close() mq_send() // , mq_receive() ­ ­ , · mq_notify() // Unix sem_open(), sem_close() sem ... URL: http://www.ispras.ru/preprints/docs/prep_14_2006.pdf . ... URL: http://www2.fisica.unlp.edu.ar/electro/temas/p7/POSIX4.pdf POSIX ( POSIX 1003.1 POSIX.4) .. ...

Еще в разделе: (Показать все результаты (>7) - lvk.cs.msu.su/ )

• http://lvk.cs.msu.su/~bahmurov/course_realtime/papers/balashov_et_al_eucass2011_monitoring.doc

GSK-3 Inhibitors: The Dataset . ... We suppose that it will be useful for the other researchers in the field of chemoinformatics; the main peculiarity of this Dataset is wide activity range of compounds and significant diversity of the actives (true inhibitors). ... IC50 is given in nM (sic!) according to the data reported in the article. It's a text field (as well as the other raw activity data fields) and values like '>10000' are given for inactive compounds. ...

Еще в разделе: (Показать все результаты (>3) - qsar.chem.msu.ru/ )

• Home - Laboratory of Medicinal Chemistry

... The idea of the project was proposed by Rector of Lomonosov Moscow State University, academician Sadovnichy V.A. in 2009. ... The strategic project objective is the formation of a nationwide highly qualified Supercomputing Technology and Software specialist training system. ... The nationwide system of Research and Education Centers for Supercomputing Technologies (REC SCT), incorporating all Russian Federal Districts, formed the basis for the successful implementation of the project. ... Trainings ...

Еще в разделе: (Показать все результаты (>46) - hpc.msu.ru/ )

• Supercomputing Education Project | Moscow University Supercomputing Center
• MSU SUPERCOMPUTERS: "LOMONOSOV" | Moscow University Supercomputing Center
• Series of Books тАЬSupercomputing EducationтАЭ | Moscow University

... Laboratory of Physical Chemistry of Modified Surfaces . ... Job and Diploma/PhD . ... In the laboratories of Micro- and Nanofluidics (MSU) and Physical Chemistry of Modified Surfaces (IPCE RAS) we are permanently recruting new PhD and Masters (Diploma) students. Applicants for a PhD position should have a very good Masters degree or Diploma in Chemistry, Physics, or similar areas (for example: Material Sciences, Chemical Engineering, Physical Chemistry, Biophysics, Applied Mathematics). ...

Еще в разделе: (Показать все результаты (>33) - nanofluidics.phys.msu.ru/ )

• Teaching
• Laboratory of Micro- and Nanofluidics

... Полная версия: Zabriskie Point . Грация-МГУ::Форум > Мультимедия > Видео . Старый сисадмин . Nov 27 2007, 01:30 . ... Какая версия была оригинальной - итальянская или американская? ... А мне вот и американская, и итальянская версия кажутся одинаково аутентичными.. ... Цитата(Старый сисадмин @ Nov 29 2007, 11:35) . ... barsik . ... Цитата(barsik @ Nov 29 2007, 12:45) . ... Это текстовая версия - только основной контент. ...

Еще в разделе: (Показать все результаты (>4) - grace.msu.ru/ )

• Zabriskie Point - Грация-МГУ::Форум

... He distributes these gifts in sacks (each sack can contain from 1 to n items) and puts the sacks with gifts around the Christmas tree (only the content of the sacks and their ordering on the circle around the tree are important). ... A river falling into a sea forms a delta which is a system of branches consisting of channels without inner intersections. (a) Suppose that in a given delta there are exactly n different (i.e. differing by at least one channel) routes down the stream. ...

219. http://www.fbm.msu.ru/sci/conf/2013/mio/infletter-e.pdf

220. EUROMECH Colloquium-458