... Русский English . Background . ... The Faculty of Bioengineering and Bioinformatics, Lomonosov Moscow State University was founded in 2002 with the express purpose of training of highly qualified personnel for the universities, research institutes, medical companies and facilities, and pharmaceutical and biotechnology industries. ... Each of FBB students is to successfully complete and defend three yearly research projects, in bioinformatics, biochemistry, and bioengineering. ...

Еще в разделе: (Показать все результаты (>2) - en.fbb.msu.ru/ )

• BackgroundтАФ Faculty of Bioengineering and Bioinformatics, MSU

.. , . . , (e-mail: eakubl@yandex.ru) , , , , tolerance, interethnic tension, interethnic and interfaith relations, conflict potential, migration . - . The article deals with the vital issue of Interethnic and interfaith tolerance in view of the growth of national tension and conflict potential in some Russian regions. The author turns to the results of monitored sociological interviews made by the Institute of Sociopolitical Researches of the Russian Academy of Sciences.

Еще в разделе: (Показать все результаты (>47) - vestnik.socio.msu.ru/ )

• http://www.socio.msu.ru/vestnik/archive/2012/1/05.pdf
• http://www.socio.msu.ru/vestnik/archive/2011/1/12.pdf
• http://www.socio.msu.ru/vestnik/archive/2010/4/11.pdf

... Real environments where objects are settled down are non-uniform and they are the source of many physical problems of acoustical imaging. ... Two groups of methods of image reconstruction in non-uniform environments are considered, and the basic attention is given to nonlinear phase methods as unlike methods of the first group, wave front inversion by matched filtering processing, they do not require detailed knowledge of parameters of the non-uniform medium. ... Acoustics of non-uniform mediums. ...

Еще в разделе: (Показать все результаты (>93) - www.msm.biophys.msu.ru/ )

... One of the project objectives was to investigate practical efficiency of some modern iterative methods, including multigrid techniques and domain decomposition methods as well as methods for small compressible materials. ... Hence, the project research initiated because of INTAS financial support contributes in setting up modern computational techniques in tire design. ... Research on efficiency of iterative methods was conducted at the department of Mechanics of Composites about ten years ago. ...

Еще в разделе: (Показать все результаты (>4) - composite.msu.ru/ )

• Department of the Composites Mechanics

... Программы обучения . ... Пропустить категории курсов . ... Пропустить новости . ... от Администратор ЦДО Ф/Ф МГУ - Понедельник 4 Август 2014, 09:53 . 04 августа 2014 года в Интеллектуальном центре ? ... Российские ВУЗы все чаще переходят на дистанционное обучение . ... ДИСТАНЦИОННЫЕ ПОДГОТОВИТЕЛЬНЫЕ КУРСЫ ФИЗИЧЕСКОГО ФАКУЛЬТЕТА МГУ ПО ФИЗИКЕ И МАТЕМАТИКЕ Пропустить Страницы ЦДО в социальных сетях . ... Центр дистанционного образвания физического факультета МГУ им. М.В. Ломоносова 2007-2012 . ...

Еще в разделе: (Показать все результаты (>53549) - distant.phys.msu.ru/ )

... The linguistic aspects of the model and the properties of the semantic dictionary ensuring the content analysis with compression of the text structure are considered. Our dictionary resources serve an instru- ment for building a multilevel textual semantic structure. ... Reason (A,B), where SemF(A) = SIT or a whole semantic formula; the same for SemF(B). ... Sem(SIT)R . ... Semantic Resources for Textual Content Compression // Fourth International Conference on Meaning-Text Theory (MTT'09). ...

Еще в разделе: (Показать все результаты (>4) - leontyeva.srcc.msu.ru/ )

. HOME . ABOUT . RESEARCH . NEWS . PUBLICATIONS . DATA . COLLABORATION . OUTREACH . CONTACT US . news . Panasyuk M. (SINP, Russia). Relec . Klimov S. (ISR, Russia). Wave Research... (SINP, Russia). Relec 1th results . Bogomolov V., Iudin A. (SINP, Russia). Relec TGF-GRB . Bogomolov A., Myagkova I. (SINP, Russia). Hi-energy electrons research...

Еще в разделе: (Показать все результаты (>4) - vernov-relec.sinp.msu.ru/ )

... Vol. ... Translated from Biofizika; Vol. ... CELL BIOPHYSICS Effects of Electric Field on Spatiotemporal Patterning in the Reaction-Diffusion System A. I. Lobanov-, T. Yu. ... Abstract-A model is proposed that describes electrodiffusion in the layer adjacent to the cell membrane. The model takes into account chemical reactions at the membrane, Coulomb interactions between particles, their random motion (diffusion), and the effect of an external electric field. ... BIOPHYSICS Vol. ...

Еще в разделе: (Показать все результаты (>37) - library.biophys.msu.ru/ )

• http://library.biophys.msu.ru/PDF/3340.pdf
• http://library.biophys.msu.ru/matorin/3397.pdf
• http://library.biophys.msu.ru/PDF/3345.pdf

... The principal possibility of solving this problem is shown. Use of neural network architecture let to detect fluorescence of nanodiamonds against the background autofluorescence of egg white with high accuracy - better than 3 ug/ml. International Science Index Vol:8, No:10, 2014 waset.org/Publication/9999549 Keywords--Artificial neural networks, fluorescence, data aggregation. ... Thus, fluorescence spectra of nanoparticles and egg white are largely overlapping structureless bands. ...

Еще в разделе: (Показать все результаты (>26) - rswater.phys.msu.ru/ )

• http://rswater.phys.msu.ru/Assets/Water/LasPhys2005.pdf
• http://rswater.phys.msu.ru/Assets/Water/OMNN_2010.pdf
• http://rswater.phys.msu.ru/en/articles/2014/JBO_19_11_117007.pdf

Dynamo Theory and Earth's Magnetic Field Paul Demorest May 21, 2001 1 Intro duction The Earth's magnetic field belongs in that class of physical phenomena which are commonplace yet also very complex. ... 3 Single Disc Dynamo Before we dive into the mess of equations and approximations that describe how fluid motion and magnetic field interact, it is useful to demonstrate a very simple system which exhibits dynamo action. ... A system without fluid motion cannot support a magnetic field indefinitely. ...

Еще в разделе: (Показать все результаты (>12) - ocean.phys.msu.ru/ )

• http://ocean.phys.msu.ru/courses/geo/lectures-addons/02/2006%20Wood%20et%20al.%2C%20Accretion%20of%20the%20Earth%20and%20segregation%20of%20its%20core.pdf
• http://ocean.phys.msu.ru/courses/stathyd/2001%20Ferrari%20et%20al.%2C%20The%20temperature-salinity%20relationship%20of%20the%20mixed%20layer.pdf
• http://ocean.phys.msu.ru/courses/stathyd/2005%20Smyth%20et%20al.%2C%20Differential%20diffusion%20in%20breaking%20Kelvin-Helmholtz%20billows.pdf

. Laboratory Head: L.K.Gladilin, tel: (+7 495) 939 3568 , fax: (+7 495) 939 3064 , . Сотрудники Лаборатории (LHPR staff) . Web-pages: . L.K.Gladilin , . V.I.Rud , . I.A.Korzhavina , . Information for our Guests . Справка о создании и первом периоде работы лаборатории, подготовленная в 1980 г. Research Activities: . Scientific Information Search Engines : inSPIRE , ScienceResearch , Google Scholar . Scientific Servers : Interactions , AIP , Elements , Scientific . Feedback: Last modified on March 1, 2016.

Еще в разделе: (Показать все результаты (>13) - lhe.sinp.msu.ru/ )

• Leonid Gladilin's Home Page
• Atlas

... Vernadskogo 78, Moscow, 119454 Russia e mail: fedyanin@nanolab.phys.msu.ru Received June 23, 2011 a Local polarization properties of a gold subwavelength grating with plasmon induced linear dichroism are studied by scanning near field optical dynamic polarimetry. ... Scanning near field optical microscopy images of (a) the nanograting sample obtained without intensity modulation and (b, c) the sample illuminated with intensity modulated linearly polarized light. ...

Еще в разделе: (Показать все результаты (>61) - nanolab.phys.msu.ru/ )

• http://nanolab.phys.msu.ru/sites/default/files/optexp20_10538_2012.pdf
• http://nanolab.phys.msu.ru/sites/default/files/bras43.pdf
• http://nanolab.phys.msu.ru/sites/default/files/acsphotonics.pdf

... Rapid developments of lasers and particle accelerators resulted in implementation of laser plasma X-ray sources and free electron lasers for various experiments requiring high intensity, shrt duration and monochromatic X-ray radiation. ... BASICS AND APPROACH Thirty years development of laboratory X-ray lasers allowed to reach ~0.1 keV photon energy of coherent X-ray beams in a repetitive mode. ... X-rays originate from Thomson scattering of counter propagating laser and electron beams. ...

Еще в разделе: (Показать все результаты (>6) - miles.sinp.msu.ru/ )

• http://miles.sinp.msu.ru/files/Instr&Exp_Tech_Engl.pdf

... Correlative immunostaining with anti-tubulin antibodies and electron microscopy established that apparent free microtubules observed in vivo were not growing ends of long stable microtubules. ... A) Plus and minus ends of free MTs; (B) ends of long MTs. ... Minus ends of free MTs in PtK1 cells are stable The production of free minus ends of MTs in PtK1 cells has now been observed by three pathways: self-assembly in the cytoplasm, release from the centrosome (Keating et al., 1997) and breakage of MTs...

Еще в разделе: (Показать все результаты (>37) - cellmotility.genebee.msu.ru/ )

• http://cellmotility.genebee.msu.ru/html/articles/alieva94.pdf
• http://cellmotility.genebee.msu.ru/html/articles/uzbekov96.pdf
• http://cellmotility.genebee.msu.ru/html/articles/amchencova98.pdf

Discrete mechanics: a sequential growth dynamics for causal sets that is based on binary alternatives arXiv:1106.6269v1 [gr-qc] 11 May 2011 Alexey L. Krugly Abstract One of approaches to quantum gravity is different mo dels of a discrete pregeometry. ... These primitive pro cesses are called monads [11]. ... Two new maximal monads and one new minimal monad appear. ... The probability of elementary extension to the future depends only on the past sets of maximal monads that take part in this extension. ...

Еще в разделе: (Показать все результаты (>16) - temporology.bio.msu.ru/ )

• http://temporology.bio.msu.ru/EREPORTS/krugly_amplitudes.pdf
• http://temporology.bio.msu.ru/EREPORTS/krugly_discrete.pdf
• http://temporology.bio.msu.ru/EREPORTS/krugly_a-sequential-growth.pdf

... 6, February, 2015 SESSIONS OF THE WORKSHOP OF THE MATHEMATICS AND MECHANICS DEPARTMENT OF LOMONOSOV MOSCOW STATE UNIVERSITY, "URGENT PROBLEMS OF GEOMETRY AND MECHANICS" NAMED AFTER V. V. TROFIMOV D. V. Georgievskii and M. V. Shamolin UDC 51(09) (For the b eginning of the list of sessions see J. Math. ... For these coefficients, we construct a recurrent system of ordinary differential equations. ... Some problems of microp olar elasticity theory. ... Stability of nonconservative mechanical systems. ...

Еще в разделе: (Показать все результаты (>36) - shamolin2.imec.msu.ru/ )

• http://shamolin2.imec.msu.ru/art-160-1.pdf
• Deep Purple Discography

... Dear creators of the Bensons courses! First of all I would like to thank you for such a magnificent English course! ... Look, it's really much more interesting - to listen to a virtual book, to look through the pictures, let alone role-play! ... However, I'm very glad that I took up "Bensons" - the course has given me wonderful possibilities to learn more about English culture, to fill some gaps in my knowledge of English grammar and just to spend my time with great pleasure and benefit! ...

Еще в разделе: (Показать все результаты (>10) - anazarenko.ffl.msu.ru/ )

Lomonosov project . ... Mikhail Lomonosov . ... The studies of Lomonosov determined profile of Russian science forever, and we appreciate the discoveries of the leading Russian scientists as the studies of his direct learners and successors. A recognized and the most significant input of Lomonosov into natural science is molecular-kinetic theory of heat, developed during the prevalence of theory of specific fiery matter ? ... Lomonosov?s theory drawn wide response in European science. ... Aurora. ...

Еще в разделе: (Показать все результаты (>16) - lomonosov.sinp.msu.ru/ )

• Automatic gaze stabilization corrector | Университетский спутник "Ломоносов"

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>12) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/batmas30.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/bmc_genom2_2013.pdf

html head title Перемещение слоя в режиме drag /title script language= javaScript !-- var app; var szx = 0 ; var szy = 0 ; function start_drag () { app = document.applets.red; app.open_change_mode(0); rc = app.set_current_layer(' show '); if( rc==-1 ) {alert( Нет указанного слоя show ); return ;} app.set_ drag _layer( show ); drag (); ...

Еще в разделе: (Показать все результаты (>25) - adept.srcc.msu.ru/ )

• http://adept.srcc.msu.ru/adept/java/applet_book/ch_box/ch2text1.htm
• http://adept.srcc.msu.ru/adept/java/applet_book/drag/drag2text1.htm
• http://adept.srcc.msu.ru/adept/java/applet_book/ch_box/ch1text1.htm