... 209 ­ 212 209 THE ROLE OF THE NATIVE POND ODOR IN ORIENTATION OF THE GREEN TOAD (Bufo viridis LAUR.) YOUNGS-OF-THE-YEAR V. V. Shakhparonov1 and S. V. Ogurtsov 1 Keywords: toadlets, orientation, native pond odor, buffer zone, periods of learning. ... Individuals from the "buffer" zone prefer the native pond water during a week before the beginning of dispersal (as described by a distribution stability coefficient S; Fig. ... The latter are, probably, individuals ready for dispersal. ...

Еще в разделе: (Показать все результаты (>47) - vertebrata.bio.msu.ru/ )

• Background of the Department
• Выступления студентов и аспирантов на конференциях
• Student Reports at International Conferences

... Next Routine] [List of Routines] NAME: ADD_HEADER PURPOSE: addition information from FITS-headers MPFS-frames DESCRIPTION: The function computes the total exposure, mean value zenit distance and modified FITS header CALLING SEQUENCE: Result =ADD_HEADER( headers ) CATEGORY: reduction MPFS-data INPUTS: Headers = String array FITS-headers from the MPFS data OUTPUTS: Header = String array containing the header from the FITS file. ... OPTIONAL INPUT KEYWORD PARAMETERS: BEFORE = Keyword string name. ...

Еще в разделе: (Показать все результаты (>46) - sn.sai.msu.ru/ )

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>17) - mouse.genebee.msu.ru/ )

• ConClus
• Nhunt: program for nucleic acid sequence similarity search
• Nhunt

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/bmc_genom2_2013.pdf

... Geography of World Economy . ... Recreational Geography and International Tourism . ... Physical Geography and Landscape Science . ... Field stations . ... Educational council . Science . ... International commission on continental erosion . ... Field training . ... Type of field courses . ... Interuniversity council for erosion and fluvial.. ... International programme in Natural Resource Management and Law offers a unique combination of Natural and Environmental Sciences and Science of Law. ...

Еще в разделе: (Показать все результаты (>110) - eng.geogr.msu.ru/ )

• THE MAKKAVEEV LABORATORY OF SOIL EROSION AND FLUVIAL PROCESSES
• Interdisciplinary seminars
• Department of Land Hydrology

. To see a Russian version of this page click here . (Senior Researcher. Graduated from Moscow State University (MSU) in 1982, Ph.D. 1986, MSU) . A member of EAS and IAU. Fields of interest: hot massive stars, close binary systems: optical photometric and spectral observations, X-ray observations; ill-posed problems, X-ray astrophysics. My publications (ADS link) . Linux on CLEVO 8750 (old stuff) . Phones/addresses of my university mates graduated in 1982. E-mail: igor@sai.msu.ru .

Еще в разделе: (Показать все результаты (>15) - uranus.sai.msu.ru/ )

• Eugene Trunkovsky

Session Start: Thu Sep 04 15:17:41 1997 . ASA_ECTb> Уж приходит дождливая осень . JamOUT> На окне - капли стылые дня . ... Master_> О чем сказал? ... Valka> где кажется весь мир земной . Sol> избавлен от ночной проказы . ... Sol> значит, далеко еще метели. ... Sol> значит снова ветер дует в грудь, . ... Master> Значит снова наступил рассвет . Valka> Значит не один на этом свете, . ... ASA_ECTb> Значит, Бог судьбу твою отметил . Master> Значит жить нам вместе много лет. ...

Еще в разделе: (Показать все результаты (>18) - asa.guru.ru/ )

• Буриме от 5 сентября 1997 года
• Буриме от 11 сентября 1997 года
• Буриме от 11 ноября 1997 года

About Department of Crystallography and Crystal Chemistry . Department of Crystallography and Crystal Chemistry was founded in Lomonosov Moscow State University by Correspoding Member of USSR Academy of Sciences Prof. G.B. Bokii in 1949. ... During all the time X-ray crystal structure determination of new minerals and their synthetic analogues remains the major part of scientific researches of the Department. ... Prof. N.N. Eremin), X-ray diffraction and crystal structure analysis (Prof. D.Yu. ...

Еще в разделе: (Показать все результаты (>23) - cryst.geol.msu.ru/ )

... ENGLISH LITERATURE QUIZ Circle the letter which corresponds to the correct answer in the following questions: 1. The starting point of English Literature is the ..... a) 5th century century 2. ... Henry Howard, Earl of Surrey a) introduced the genre of sonnet into English literature b) translated Petrarch`s sonnets into English c) modified the traditional form of the sonnet 5.The main poetic device used by Christopher Marlowe in his plays was a) rhyme b) blank verse c) Spencerian stanza 6. ...

Еще в разделе: (Показать все результаты (>75) - ffl.msu.ru/ )

• http://www.ffl.msu.ru/research/vestnik/4-2011-Ilson.pdf
• About Us

... Home > Open Conference Systems . ... History of the ICONO series goes back to 1965 and the LAT series of the conferences started in 2002. ICONO/LAT 2016 will be held in Minsk, the capital and largest city in Belarus, The oldest mentions of Minsk date back to 1067. In 1242 Minsk became a part of the Grand Duchy of Lithuania and received its town privileges in 1499. ... During 1919-1991 Minsk was the capital of the Soviet Belarus, which became in 1991 an independentб  state. ...

Еще в разделе: (Показать все результаты (>49) - hea.phys.msu.su/ )

• Call for Papers
• Browse Title Index

Dear friends, It is less than three weeks left till the 39th IChO starts. ... Currency and cards. Russian rouble is the only currency accepted throughout Russia. ... To attention of Head mentors intending to pay fees on arrival in cash: payments will be accepted in Russian roubles only. ... During the IChO, mentors and guests will stay in Holiday Inn Sokolniki, and students in the Olympian camp, which is also an option for early arrivals and late departures. ... The 39th IChO Organizing Committee ...

Еще в разделе: (Показать все результаты (>2) - icho39.chem.msu.ru/ )

... В левой части открывшегося окна Group Policy найдите раздел Local Computer Policy | ... Windows Update . ... Дважды щелкните по строке Configure Automatic Updates , в открывшемся окне поставьте переключатель в положение Enabled. ... Задав настройки для параметра Configure Automatic Updates, щелкните Next Policy и в окне Specify intranet Microsoft update service location Properties поставьте переключатель в положение Enabled, а в обоих полях ввода текста обязательно введите http://wsus.chem.msu.ru . ...

Еще в разделе: (Показать все результаты (>2) - netadmin.chem.msu.ru/ )

Contemplating the evolution of Surface Nonlinear Optics seems to be highly instructive, able to stimulate one's own creativity and deeper understanding of current trends in this field. ... Hence, the Surface Nonlinear Optics Map, in its starting version, presents the names of researchers having made prominent scientific contributions to this branch of Optics. Related websites are accessible by clicking the corresponding names. ...

Еще в разделе: (Показать все результаты (>37) - shg.phys.msu.ru/ )

• Milestones of the lab highway

... THE TIME HAS COME FOR "THUNDER BOOKS" . ... You may have forgotten what a thunder book is, or maybe you didn't ever use that name. ... It is a handy reference to those things you need to know about soils and how they behave. ... Well, if you knew how to use them as pages in a thunder book it would surely be a good start, but you need something uniquely yours. ... It has always been my belief that the mission of a soil survey is to help people understand and wisely use soil resources. ... Good read. ...

Еще в разделе: (Показать все результаты (>4) - www.paleopedology.msu.ru/ )

... Processes of regionalization in Post-Soviet space: contradictions of Russia-Belarus Integration. Moscow, Institute of economy RAS, 2010. ... Eurasian Economic Integration. ­ 2010, 1. 4. 10 years of EurAsEC: everything is just starting (in co-authorship with R. Grinberg)./ ... Scientific Reports of the Institute of Economics of RAS. ... Analytical Bulletin of the Centre for Problems of Globalization and Integration of Institute of economics of Russian Academy of Sciences", 2007, Issue 4 (12). ...

Еще в разделе: (Показать все результаты (>19) - www.mse-msu.ru/ )

• http://www.mse-msu.ru/Russia_2010_MSE_en.pdf
• http://www.mse-msu.ru/Ayvazyan_Introduction_to_the_textbook_on_econometrics.pdf
• http://www.mse-msu.ru/Nekipelov_comment_on_reserve.pdf

Стратегия здравоохранения относительно загрязнения питьевой воды мышьяком, марганцем, ураном и другими ядовитыми элементами в Западном Бангладеш. ... Для более чем 60 000 000 жителей Бангладеш питьевая вода представляет опасность, так как содержит большие концентрации загрязняющих веществ. ... Исследованы источники питьевой воды в различных регионах западного Бангладеш на содержание мышьяка, бора, бария, хрома, урана и др. химических элементов. ...

Еще в разделе: (Показать все результаты (>20) - ecoinformatica.srcc.msu.ru/ )

Available on CMS information server CMS NOTE 2000/065 The Compact Muon Solenoid Experiment Mailing address: CMS CERN, CH­1211 GENEVA 23, Switzerland CMS Note ``SingleTop'' ­ an event generator for the single top quark production at the LHC. ... But this process has sufficiently different signature which is similar to the top quark pair production signature. ... The events for the two main processes of the single top quark production at the LHC are available in the CMS processes data base PEVLIB [14]. ...

Еще в разделе: (Показать все результаты (>6) - top.sinp.msu.ru/ )

NMW survey overview . Access image archive . ... The New Milky Way survey aims to detect bright (V<13.5) optical transients near the Galactic plane using an automated wide-field (8x6 deg.) system capable of surveying the whole Milky Way area visible from the observing site in one night. ... All images obtained during the transient search survey are available online (please use the image archive access form ). ... Images per field: . ... Images per night: . ... Milky Way imaging time: . ...

Еще в разделе: (Показать все результаты (>2) - scan.sai.msu.ru/ )

... info@ecfs.msu.ru . ... Topic 2: Barriers to Sustainable Soil.. ... We are inviting you to participate in our consultation on "Barriers to Sustainable Soil Management in Eurasia and possible ways for overcoming them".љ ... Is workforce capacity in the Eurasian region sufficient for adopting sustainable soil management practices? ... Мы приглашаем вас принять участие в нашей консультации "Барьеры на пути к устойчивому землепользованию в Евразии и возможные пути их преодоления".љ ... Topic 2 . ...

Еще в разделе: (Показать все результаты (>14) - ecfs.msu.ru/ )

• Topic 1: Building the Eurasian Food Security Network / Создание Евразийской
• Online Consultation on Network and Partnerships in the area of Food Security |

... It is shown that brief exposure to a low-frequency magnetic field at the stage of release of the esterases in the course of swelling of wheat seeds greatly speeds up the release of enzymes from the bound state and also the release of seeds from the dormant state. ... The germinating power and the rate of germination of such seeds also sharply increased. ... Taking all this into account, for the study of e.m.f. effects, we chose wheat seeds at the initial stages of germination. ... Seed variety . ...

Еще в разделе: (Показать все результаты (>31) - www.library.biophys.msu.ru/ )