... Minimal size of Clud clusters (residues) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Hydrophobic cluster of a single protein structure is a separated pool of nonpolar atoms. Usually there is the biggest cluster in the protein called hydrophobic core. ... ConClus program is able to detect of conservative hydrophobic clusters for a family of related protein domains or just for a set of aligned proteins. ...

Еще в разделе: (Показать все результаты (>13) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• Nhunt: program for nucleic acid sequence similarity search
• Nhunt

ISSUE 1 RUSSIA U.S. BILATERAL ON CYBERSECURITY CRITICAL TERMINOLOGY FOUNDATIONS APRIL 2011 The Russia U.S. Bilateral on Cybersecurity ґ Critical Terminology Foundations Issue 1 The principle editors of this document are: Karl Frederick Rauscher, EastWest Institute and Valery Yaschenko, Information Security Institute of Moscow State University. ... INFORMATION AND CYBER .. ... Scientific Adviser to the Director of the Lomonosov Moscow State University Institute of Information Security Issues. ...

Еще в разделе: (Показать все результаты (>13) - iisi.msu.ru/ )

... Font: Times New Roman . ... size - А4 (21 cm х 29,7 cm) . ... Title should be typed in capital letters, Times New Roman, size 13, boldface font; formatting: center. ... The title and the number of the table should be center-formatted (Times New Roman, size 11, single-spaced, no period/full stop at the end of the title). ... The title under the illustration should be center-formatted (Times New Roman, size 11, single-spaced, no period/full stop at the end of the title). ... Use Times New Roman size...

Еще в разделе: (Показать все результаты (>60) - www.spa.msu.ru/ )

• Содержание выпусков

... In the given practical special course we address user techniques for working with Linux OS; we study the interface of the command line in great detail, methods of automation and batch processing, composition of scientific articles as well as the specifics of software design by using in-built toolkit. ... The first version of the nucleus of Linux operating system was written more than 20 years ago by a student, just like you, as his second-year coursework. ... Sekunov N. Programming on C++ in Linux. ...

Еще в разделе: (Показать все результаты (>12) - engineering.phys.msu.ru/ )

• Science Festival 2013

Announcement On November 2-3, 2005 Lomonosov Moscow State University will conduct jointly with the Academy of Cryptography of the Russian Federation the Fourth All- Russian Conference Mathematics and Security of Information Technologies [Cybersecurity?] and jointly with the Center of International Studies, Cambridge University , United Kingdom, Advanced Research Workshop Unconventional ... Sherstyuk V.P. - Security Council of the Russian Federation; 3. ... Organization Committee 1. ...

Еще в разделе: (Показать все результаты (>12) - suny.msu.ru/ )

• http://suny.msu.ru/ru/ProgramMaBIT05En.doc
• Центр по делам России и США :: Публикации

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

... 2) Faculty of Soil Science, Moscow State University, Moscow, 119899, Russia . ... Space variability of acidity and exchangeable cations is analysed in surface soil organic horizons of podzols in pine and birch forests on the northern tree line near the major pollution source in European North ? the Pechenganikel smelter in the Kola Peninsula, Russia. Multivariate analysis show that both natural and anthropogenic factors effect the acidity and exchangeable cation content in soil organic horizons. ...

Еще в разделе: (Показать все результаты (>20) - eco.soil.msu.ru/ )

• Acid Deposition and Forest Soils. Eds. V.Nikonov G.Koptsik
• Forest Soil Response to Acid Deposition

... Laboratory of laser spectroscopy of solutions of supramolecular compounds and nanostructures is very young. We have grown up in the laboratory of laser spectroscopy of water media. ... Use of such powerful modern tools of solution of inverse problems and problems of optimization provides successful solution of a wide range of applied problems of diagnostics and analysis of water media. ... 2016 Laboratory of laser spectroscopy of solutions of supramolecular compounds and nanostructures . ...

Еще в разделе: (Показать все результаты (>21) - rswater.phys.msu.ru/ )

Contents Curricula, and Programs. Mathematical Analysis. (The Program of Mathematical Physics Department).............................................. Algebra and Analytical Geometry.(The program of (General "Mathematics" Department)................................ Computer and Programming. (The program of Algorithmic Languages Department).................................... The practical work on Computers.( Department of Algorithmic. Languages)............................................... Discrete

Еще в разделе: (Показать все результаты (>2) - mph.cmc.msu.ru/ )

Disjoining pressure of an electrolyte film confined between semipermeable membranes Salim R. Maduar and Olga I. Vinogradova Citation: The Journal of Chemical Physics 141, 074902 (2014); doi: 10.1063/1.4892758 View online: http://dx.doi.org/10.1063/1.4892758 View Table of Contents: http://scitation.aip.org/content/aip/journal/jcp/141/7?ver=pdfcov Published by the AIP Publishing Articles you may be interested in Order of wetting transitions in electrolyte solutions J. Chem. ... Chem.- ... Phys. Commun. ...

Еще в разделе: (Показать все результаты (>34) - nanofluidics.phys.msu.ru/ )

... Ярмарка вакансий и стажировок для студентов и выпускников вузов . Новости науки и техники События . ... Подписаться на новости . ... Computer Science . ... Software engineering for mobile devices . ... Design and development of middleware (collaboration system, context-aware system, content system) on mobile devices . Design and development of applications on mobile devices . ... 2) Embedded OS porting, system programming, Mobile OS . ... 5) Location-based service on mobile devices . ...

Еще в разделе: (Показать все результаты (>63) - www.physcareer.ru/ )

• Software Engineer (Server) / Вакансии / Physcareer.ru
• Software Engineer (Backend Servers / Web / WAP / Вакансии / Physcareer.ru
• Software Engineer (C/C++ and JAVA) / Вакансии / Physcareer.ru

Prediction of physical properties of materials based only on their chemical composition has long been an intriguing task. ... The main interests of Prof. Lebedev 's group are physical properties of crystals exhibiting structural instability, in which different phase transitions (including the ferroelectric one) can appear. ... A.I. Lebedev. ... Physics of the Solid State 51 , 362 (2009) ; e-print arXiv:1305.0240 (2013) ; [local copy] . ... Physics of the Solid State 51 , 2324 (2009) ; [local copy] . ...

Еще в разделе: (Показать все результаты (>46) - scon155.phys.msu.su/ )

• Proceedings of the Fifth Russian-Japanese Symposium on Ferroelectricity

... Gerasimov, Y., Shorokhov, V., and Snigirev, O. Electron transport through thiolized gold nanoparticles in single-electron transistor.  ... DOI  ] . ... Journal of Communications Technology and Electronics 56 , 12 (2011), 1483?1489. ... Malinin, V., Shorokhov, V., and Soldatov, E. Determination of electronic properties of molecular objects on the basis of nanodevices transport characteristics.  Proceedings of SPIE - The International Society for Optical Engineering 7521  (2010), 75210?1?75210?10. ...

Еще в разделе: (Показать все результаты (>5) - cryolab.phys.msu.ru/ )

• Publications (2001-2010)

... The literature data on the craniology of ethnic groups and territories are used. ... At the present time some of the genetic data shows some similarity between Australians and the populations of India. ... This study aims to analyze the gene pool structure of the Turkic speaking populations from North Caucasus and Transcaucasia and reveal their genetic relations with other populations of the Caucasus and neighboring regions of Eurasia. ... The age surveyed (both groups) was in a range of 17-28 years...

Еще в разделе: (Показать все результаты (>27) - www.anthropos.msu.ru/ )

• http://www.antropos.msu.ru/edu/3d.pdf
• http://www.antropos.msu.ru/vestnic/e2014_4.doc
• НИИ и Музей антропологии | Вестник Московского университета. Серия XXIII.

... defmacro defprinter ( name args &body body ) . ... body ) ) . ... defprinter :property ( type name &rest body ) . print-statement-with-body stream body nil "public ~a ~a" type name ) ) . ... defprinter :get ( &rest body ) . print-statement-with-body stream body nil "get" ) ) . ... defprinter :constructor ( name args &rest body ) . ... defprinter :class ( name &rest body ) . print-statement-with-body stream body t "public class ~a" name ) ) . ... defprinter :namespace ( name &rest body ) . ...

Еще в разделе: (Показать все результаты (>2) - depni.sinp.msu.ru/ )

Andreenko Alexander Stepanovich . Doctor of Physics and Mathematics(1994), . ... Magnetism, rare earth alloys and compounds, amorphous alloys, phase transitions. ... In 1971-1984 investigations of magnetocaloric effect in rare earth metals, compounds and alloys were taken. ... In 1980-1999 researches of magnetic and magnetoelastic properties of rare earth alloys were produced. ... Several Publications: 1) Andreenko A.S., Zvezdin A.K., Nikitin S.A., Popkov A.F. JETF, 1979,76,6, 2158-2165 . ...

Еще в разделе: (Показать все результаты (>10) - ferro.phys.msu.ru/ )

... http :// www.gpgpu.org / - пожалуй, самый популярный сайт по тематике ОВГПУ. http ://developer. nvidia .com/page/home.html - портал компании NVidia для тех, кто работает с их графическими процессорами. http ://www. nvidia .com/object/ cuda _get.html - страничка технологии NVidia CUDA . http :// ati.amd.com /developer/ index.html - портал компании Лаборатория Параллельных информационных технологий НИВЦ МГУ . ...

Еще в разделе: (Показать все результаты (>2) - gpu.parallel.ru/ )

WEB- . ... 495) 939 5560. 1 ґ 30 . ... 2) : A. IGAMBERDIEV ( ). Igamberdiev AU (2012) Physics and Logic of Life. ... BioSystems 109: 336-345, Igamberdiev AU (2008) Objective patterns in the evolving network of non-equivalent observers. BioSystems 92: 122-131, Igamberdiev AU (2007) Physical limits of computation and emergence of life. ... BioSystems 77: 47-56.) ... 1 - : DLF- TSK- ?. DLF- [Le-11] D, L, F. D ґ (http://math.bu.edu/people/levit/mem-segal.pdf), L ґ " ", F ґ " ". ... DLF - . ...

Еще в разделе: (Показать все результаты (>16) - temporology.bio.msu.ru/ )

• http://temporology.bio.msu.ru/EREPORTS/krugly_discrete.pdf

... ICONO Invited Speakers . ... Gennadiy Kulipanov, Budker Inst. of Nuclear Physics, Russia . ... Marlan Scully, Texas A&M Univ., ... Andrey Goncharov, Inst. of Laser Physics, Russia . ... Vladimir Trunov, Inst. of Laser Physics, Russia . ... Since 1987, he has worked at the National Research Council of Canada (Ottawa) in the field of laser physics and trapped ion optical frequency standards. ... Alexey Taichenachev , Inst. of Laser Physics, Russia . ... S. Vatnik, Inst. of Laser Physics, Russia . ...

Еще в разделе: (Показать все результаты (>6) - iconolat13.phys.msu.ru/ )

• Excursions

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>28) - tukachev.flogiston.ru/ )

• Category: Новости