... In my opinion, it became the landmark for Russian education. ... This means academic mobility, joint scientific research, joint development of new forms of evaluation of the quality of education, including new mechanisms of the global rating of institutions of higher education. All this will contribute to prevention of the current trend to breakage of ties between the key subjects of the educational process: students' and teachers' corporations, employers, state and social institutes. ...

Еще в разделе: (Показать все результаты (>60) - www.rsr-online.ru/ )

• http://www.rsr-online.ru/doc/norm/111.doc
• http://www.rsr-online.ru/doc/norm/327.doc
• http://www.rsr-online.ru/doc/norm/396.doc

Научная Библиотека . Отдел Обслуживания Физического Факультета МГУ . ... Phys. JAAS Journal of Analytical Atomic Spectrometry . ... Japanese Psychological Research . ... JCP: BioChemical Physics . ... Journal of Accounting Research . ... Journal of Applied Biobehavioral Research . ... Journal of Applied Ecology . ... Journal of Applied Research in Intellectual Disabilities . ... Journal of Physics D: Applied Physics . ... Научная Библиотека Физического факультета МГУ имени М. В. Ломоносова . ...

Еще в разделе: (Показать все результаты (>22) - wwwlib.phys.msu.ru/ )

• Библиотека физичеcкого факультета МГУ - Главная страница

Angular acceptance Old source E=2.8 eV, mono Update on OM GEANT4 simulation · Thin layer optical model: D. Motta, S. SchЖnert, NIMA 539 (2005) 217 Thin layer Optical Model From Motta et al paper internal note ANTARES-OPMO-2009-003 GEANT4 default Good agreement Thin layer Optical Model implemented in GEANT4 Comparison PMT Scan. Level of gel = 10.85 cm Full reflection PMT Scan. Level of gel = 11.35 cm Angular acceptance ToDo List Error calculation Final acceptance release eta_E calculation K40 rate

Еще в разделе: (Показать все результаты (>31) - antares.sinp.msu.ru/ )

• http://antares.sinp.msu.ru/docs/Anisotropy_2011Bamberg.pdf
• ANTARES в МГУ
• ANTARES in MSU

... Обучение . ... Помощь школе . ... 05.03.2015 К 50-летнему юбилею Школы им. Колмогорова была переиздана книга '18 х 18. Вступительные задачи ФМШ при МГУ'. ... официальным сайтом СУНЦ МГУ! ... СУНЦ МГУ >> . ... Вступительное задание заочного тура в Школу А.Н.Колмогорова на 2008-2009 учебный год . ... Вступительное задание заочного тура в Школу А.Н.Колмогорова на 2006-2007 учебный год . ... Проводится запись на очные курсы СУНЦ МГУ на 2011-12 учебный год . ... СУНЦ МГУ школа им. А.Н.Колмогорова . ...

Еще в разделе: (Показать все результаты (>6) - www.pms.ru/ )

... Optical metamaterials represent specially designed structures, which possess optical properties not observable for ordinary bulk medium. ... Nanophotonics of surface states in photonic crystals . Research joined under the name ?Nanophotonics of surface states in photonic crystals?, carried out in the laboratory, are aimed to the study of properties of surface electromagnetic waves (SEWs), Tamm plasmon polaritons (TPPs), guided modes, which arise inside or at the surface of photonic crystals. ...

Еще в разделе: (Показать все результаты (>167) - nanolab.phys.msu.ru/ )

• Bessonov Vladimir Olegovich | Laboratory of Nanophotonics & Metamaterials
• Ultrafast plasmonics and magnetoplasmonics | Laboratory of Nanophotonics &
• Alexandr I. Musorin | Laboratory of Nanophotonics & Metamaterials

The most up-to-date information related to atmos 3.0 are collected here due to constantly increasing interest to MASS/DIMM processing software... atmos 3.0 is still beta , so the latest version is 2.97.5 (there is also 2.98.x branch which absorbs new features) . ... M' line: . ... free seeing and its relative error . ... dimm seeing and its relative error (if dimm data are present, zeros otherwise) . ... dimm turbulence power and its relative error (if dimm data are present, zeros otherwise) . ...

Еще в разделе: (Показать все результаты (>22) - curl.sai.msu.ru/ )

• . The . MASS . Group .

... Елена Фоменко (2 курс). ... Руководитель В. И. Буник, отдел биокинетики НИИ ФХБ им. А.Н.Белозерского МГУ. ... Руководитель А.Г. Евстафьева, отдел химии и биохимии нуклеопротеидов НИИ ФХБ им. А.Н. Белозерского МГУ. ... Руководитель Н.В. Чичкова, лаборатория молекулярной биологии гена отдела химии и биохимии нуклеопротеидов НИИ ФХБ им. А.Н. Белозерского МГУ. ... Руководитель А.Г. Евстафьева, лаборатория молекулярной биологии гена отдела химии и биохимии нуклеопротеидов НИИ ФХБ им. А.Н. Белозерского...

Еще в разделе: (Показать все результаты (>3) - www.fbb.msu.ru/ )

• Факультет биоинженерии и биоинформатики МГУ имени М.В.Ломоносова

... Bohm limit DB=vrg/3: Emax Emax ush 0.3 Ze B Rsh c 1014(B/Bism) Z eV B Hillas criterion ! ... Voelk 2000; Kang Jones 2006) - Bohm diffusion in amplified magnetic field B2/8 = 0.035 u2/2 ( Voelk et al. 2005 empirical; Bell 2004 , Zirakashvili VP 2008 theoretical) - account for Alfvenic drift w = u + Va upstream and downstream - relative SNR rates: SN Ia : IIP : Ib/c : IIb = 0.32 : 0.44 : 0.22 : 0.02 Chevalier 2004 , Leaman 2008, Smart et al 2004, Berezinsky et al 2006 Das et al. ...

Еще в разделе: (Показать все результаты (>8) - tunka.sinp.msu.ru/ )

• http://tunka.sinp.msu.ru/en/presentation/Zirakashvili.pdf
• Workshop тАЬCosmic Ray Physics Large Scale Experiments at the Second Decade of

системы автоматизации, автоматизированные системы , информационные системы , мобильные и встраиваемые системы , программное обеспечение, вычислительные системы , средства связи,базы данных, информационные технологии,технологии программирования, обработка изображения, параллельные вычисления, информационное моделирование,математическое моделирование, вычислительный эксперимент, информатика,методы вычислений, численный анализ, numerical ...

Еще в разделе: (Показать все результаты (>5) - adept.srcc.msu.ru/ )

... The RELEC experiment was specially developed for study of relativistic electrons in near-Earth space together with TLEs in order to test possible connection between these two phenomena. ... Data from RELEC mission will be processed for testing TLE models, studying of TGF light curves and spectra, testing possible connection between electron precipitations and low-frequency electromagnetic waves. ... Energy range: 0.1 - 15 MeV (for electrons) . ...

Еще в разделе: (Показать все результаты (>8) - vernov-relec.sinp.msu.ru/ )

... Living systems depository "Noah's Ark" . ... About the project . ... The project of the Moscow State University "Noah's Ark" is dedicated to the creation of multi-functional network storage of biological material. ... Creation of temporary prototypes of living systems depository bank for storage and research of the collected material. ... Development of algorithms for the information processes analysis in living systems for receiving, filing and processing of various types of biological data. ...

Еще в разделе: (Показать все результаты (>8) - depository.msu.ru/ )

• Biological information | depozitariy
• Animals | depozitariy

... Сектор информатики и биофизики сложных систем . ... О секторе . ... Учебная работа сектора включает лекции, семинары, практические занятия по информатике и математическому моделированию в биологии, биофизике, экологии на всех 5-ти курсах обучения на кафедре биофизики. ... Диффузия и взаимодействие белков в биологических мембранах? консультанты Ризниченко Г.Ю. , Рубин А.Б. Рабочие семинары сектора информатики и биофизики сложных систем проходят по четвергам в 11:00 в аудитории 124 (компьютерный класс...

Еще в разделе: (Показать все результаты (>12) - www.biophys.msu.ru/ )

• Устинин Дмитрий Михайлович
• (Chlorophyll Fluorescence in vivo: A Theory
• MEASURING THE PHYTOPLANKTON PHOTOSYNTHESIS RATE USING A PUMP-AND-PROBE

Cell Biology International 27 (2003) 293­294 Cell Biology International www.elsevier.com/locate/jnlabr/ycbir Short communication Microtubule dynamics in living cells : direct analysis in the internal cytoplasm Ivan A. Vorobjev a a,* , Irina B. Alieva a, Ilya S. Grigoriev b, Gary G. Borisy c Laboratory of Cell Motility, A.N. Belozersky Institute, Moscow State University, Moscow, Russia b Department of ... These data demonstrate that MT growth is impeded at the cell margin. ...

Еще в разделе: (Показать все результаты (>41) - cellmotility.genebee.msu.ru/ )

• Alieva Irina
• Smurova Xenia

... Aerospace and environmental medicine Automation and Remote Control Optoelectronics, Instrumentation and Data Processing Acoustical Physics St Petersburg Mathematical Journal Algebra and Logic Angiologiia i sosudistaia khirurgiia = Angiology and vascular surgery Anesteziologiya i Reanimatologiya Antibiotiki ... Moscow University Mathematics Bulletin . ... Moscow University Chemistry Bulletin . ... Mathematics - , . ... Physics, Chemistry, Mathematics Nauchno-Tekhnicheskaya Informatsiya. ...

Еще в разделе: (Показать все результаты (>5) - geol.msu.ru/ )

Here are examples of an alignment for input for the program " LCore ". ... 1NK2 (TGTGTCAAGTGGCTGT):A.P/1 (ACAGCCACTTGACACA):B.P/1 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/1 1NK2 (TGTGTCAAGTGGCTGT):A.P/2 (ACAGCCACTTGACACA):B.P/2 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/2 1NK2 (TGTGTCAAGTGGCTGT):A.P/3 (ACAGCCACTTGACACA):B.P/3 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/3 ...

Еще в разделе: (Показать все результаты (>6969) - mouse.belozersky.msu.ru/ )

• Index of /npidb/pdb
• wLake program homepage

. Please standby and you will be automatically connected to the new location of the unframed Supernova page. Or, click on the link above. If you have questions or problems, please email me at David Bishop dbishop@vhdl.org . Last modified: Mon Aug 27 12:40:15 EDT 2001

Еще в разделе: (Показать все результаты (>31) - www.rochesterastronomy.org/ )

... Individual SELEX products, aptamers, are small molecules (40­100 nt) that have a unique three-dimensional structure, which provides for their specific and high-affinity binding to targets varying from low-molecular-weight ligands to proteins. ... Selection of aptamers binding with a target is the key step in SELEX, as aptamers account for only a small fraction of the initial library (one aptamer per 109 to 1013 molecules) [6]. ... Fourth, modification can increase the aptamer affinity for a target. ...

Еще в разделе: (Показать все результаты (>7) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.ru/pages/pdf/nar2004.pdf
• http://rnp-group.genebee.msu.su/pdfs/article_vas_bioelectro.pdf
• http://rnp-group.genebee.msu.ru/pages/pdf/biochem2003.pdf

Nanoterrorism: New Responsibility for Our World and Future in the Global TechnoScience Vitaly G. Gorokhov Institute for Philosophy of the Russian Academy of Sciences, Institute of Technology Assessment and Systems Analysis of the Research Center Karlsruhe (Germany) Vitaly.Grorokhov@itas.fzk.de "Bioterrorism and chemical warfare are not unthinkable. ... 2] But these conditions do not else exist for the time being in nanoscience and nanotechnology. ...

Еще в разделе: (Показать все результаты (>20) - iisi.msu.ru/ )

• http://www.iisi.msu.ru/UserFiles/File/bayern2009/global_dns.pdf
• http://www.iisi.msu.ru/UserFiles/File/bayern2009/crain_pres.pdf
• http://www.iisi.msu.ru/UserFiles/File/bayern2009/twomey.doc

Home . Database of structures of nucleic acid - protein complexes . ... List of complexes . Pfam families . SCOP families . Interaction classes . ... NPIDB . ... Information on SCOP and Pfam domains detected in protein chains is presented. ... Each family has its own web page with the list of entries that include domains of the family. ... List of SCOP domains occurred in DNA-protein and RNA-protein complexes is organized in tree-like form, according to the SCOP classification. ...

Еще в разделе: (Показать все результаты (>13) - npidb.belozersky.msu.ru/ )

• Index of /data
• NPIDB: Download

... Author(s) : Nikolai G. Bochkarev . Pages : 0 to 0 . ... A study of thin disk with radial flow for perfect fluid disk in Kerr geometry . ... The present stellar populations and the origin of galaxies . ... Stellar subsystems of edge-on disk galaxies . ... Properties and Structural Features of Early-Type Disk Galaxies with Multi-Tier Disks . ... and LSB galaxies . ... Galactic corotation as a principal “driver" for the bimodal abundance radial distribution formation in the disk of our Galaxy . ...

Еще в разделе: (Показать все результаты (>116) - sai.msu.ru/ )

• International School "Frontiers in Numerical Gravitational Astrophysics"
• WORKSHOP "STELLAR ATMOSPHERES" "THE CHEMICAL AND DYNAMIC EVOLUTION OF STARS AND