. Name . Last modified . Size . Description . Parent Directory . - . Apache/2.2.22 (Debian) Server at do.chem.msu.ru Port 80

Еще в разделе: (Показать все результаты (>2) - do.chem.msu.ru/ )

. Name . Last modified . Size . Description . Parent Directory . - . Apache/2.2.22 (Debian) Server at edas2.bioinf.fbb.msu.ru Port 80

Еще в разделе: (Показать все результаты (>2) - edas2.bioinf.fbb.msu.ru/ )

• Index of /rat

... Ключевые слова: научно-церковная конференция ""Иисус Христос вчера и сегодня во веки Тот же": Христианство на пороге третьего тысячелетия" (Москва, 23-25 нояб. 1999 г.) ; история Русской Церкви (новейший период) . ... Журнал Московской Патриархии . ... 1 (ЖМП) . ... Ключевые слова: библиография, рецензии . ... Ключевые слова: библиография, рецензии ; библиотеки . ... Ключевые слова: библиография, рецензии ; Церкви Православные: Румынская ; периодика: "Румынская Православная Церковь" (Румыния) . ...

Еще в разделе: (Показать все результаты (>29) - www.srcc.msu.ru/ )

• http://www.srcc.msu.ru/bib_roc/bib/ItemsT44.htm
• http://www.srcc.msu.ru/bib_roc/bib/ItemsR29.htm

Contents Curricula, and Programs. Mathematical Analysis. (The Program of Mathematical Physics Department).............................................. Algebra and Analytical Geometry.(The program of (General "Mathematics" Department)................................ Computer and Programming. (The program of Algorithmic Languages Department).................................... The practical work on Computers.( Department of Algorithmic. Languages)............................................... Discrete

Еще в разделе: (Показать все результаты (>3) - mph.cmc.msu.ru/ )

... Laboratory of laser spectroscopy of solutions of supramolecular compounds and nanostructures is very young. We have grown up in the laboratory of laser spectroscopy of water media. ... Use of such powerful modern tools of solution of inverse problems and problems of optimization provides successful solution of a wide range of applied problems of diagnostics and analysis of water media. ... 2016 Laboratory of laser spectroscopy of solutions of supramolecular compounds and nanostructures . ...

Еще в разделе: (Показать все результаты (>30) - rswater.phys.msu.ru/ )

• Photo report: Participation in 21st Colloquium on High Resolution Molecular
• Photo report: Participation in XIIth International Conference on Laser
• Photo report: International scientific seminar devoted to 145th anniversary of

... Surface disturbance and deformat ion are shown in the same scale. Displac the free surface is much smoother as compared bottom deformations: init ial elevat ion has amplitude and spreads over a rather wide area. bottom theory, bottom ement of with the smaller F ­ velocity potential, H ­ depth, ­ vector of bottom deformation, 0 ­ initial elevation a . ... The init ial elevation assumed to be equal to the vertical bottom deformat ion (a); calculated with use of the Laplace smoothing algorithm (b). ...

Еще в разделе: (Показать все результаты (>14) - ocean.phys.msu.ru/ )

• http://ocean.phys.msu.ru/courses/geo/lectures-addons/12/2004%20Kanamori%2C%20%20Brodsky%20The%20Physics%20of%20Earthquakes.pdf

курсоре на всей области апплета /title /head script language= javaScript !-- var app; var new_show =''; /**********************************************************/ function re_cursor(n) { var rc; app = parent.ex.document.applets.red; switch (n) { case 1: { // Установка для показа слоя show1 new_show = show1 ; break; } case 2: { // Установка для показа слоя show2 new_show = ...

Еще в разделе: (Показать все результаты (>26) - adept.srcc.msu.ru/ )

... The time-of-flight spectra of all fragment ions were measured in coincidence with one of the emitted electrons. The cross sections of multiple ionization as well as relative yields of even-mass fullerene-type ions of various charges are deduced from experimental spectra. ... The model describes the p C60 collision as proceeding in three steps: i energy deposition by the projectile, ii emission of prompt electrons, and iii C2 evaporation and delayed electron emission. ... Phys. 33, 125 1997 . ...

Еще в разделе: (Показать все результаты (>106) - danp.sinp.msu.ru/ )

• http://danp.sinp.msu.ru/ACS_pdf/atcol_1.pdf
• http://danp.sinp.msu.ru/LIIWM/JPhysb40_2007_329.pdf
• http://danp.sinp.msu.ru/LIIWM/JPhysB40_2007_F299Kab.pdf

ISSN 0026-2617, Microbiology, 2008, Vol. ... Key words: late stationary phase, secondary growth, Pseudomonas aeruginosa, S and M dissociants, population structure of the culture. ... Growth dynamics and population composition of a mixed culture of P. aeruginosa S and M dissociants in the variant of autolysis in the late stationary phase: optical density, OD з 100 (1); ratio of the M dissociant in the population, % (2); pH (3); and content of reducing sugars, mg % (as glucose) (4). ...

Еще в разделе: (Показать все результаты (>8) - dis.bio.msu.ru/ )

Literature . ... Computers and Statistical Data Analysis. ... In Russian. ... Basic notions and methods of applied statistical analysis and usage of leading Russian and American statistical software tools: STADIA, STATGRAPHICS. ... The second edition has much more detailed depiction of temporal series analysis methods, review of statistical packages for Windows and recommendations on their choosing. ... Kulaichev A.P. Data Analysis Methods And Tools for Windows . ... In English and In Russian. ...

Еще в разделе: (Показать все результаты (>3) - statsoft.msu.ru/ )

... California Department of Education (1985), Mathematics framework for public schools, kindergarten through grade twelve. ... California Department of Education (1992), Mathematics framework for California public schools, kindergarten through grade twelve. ... California Department of Education (February 5, 1998), The California mathematics academic content standards. [ http://www.cde.ca.gov/board.html ] . ... NCTM (1998), California mathematics academic content standarts for grades K-12. ...

Еще в разделе: (Показать все результаты (>363) - www.nature.web.ru/ )

• Научная Сеть
• Поражение сердца при болезни Кавасаки у детей
• Обозначения, единицы измерения и терминология в физике

... Garbe, Dietmar Journal fЭr die reine und angewandte Mathematik Volume 237 / 1969 / Article Nutzungsbedingungen DigiZeitschriften e.V. gewДhrt ein nicht exklusives, nicht Эbertragbares, persЖnliches und beschrДnktes Recht auf Nutzung dieses Dokuments. ... Das Copyright bleibt bei den Herausgebern oder sonstigen Rechteinhabern. ... Terms of use DigiZeitschriften e.V. grants the non-exclusive, non-transferable, personal and restricted right of using this document. ...

Еще в разделе: (Показать все результаты (>45) - dfgm.math.msu.su/ )

• http://dfgm.math.msu.su/files/papers-sym/0503389v1.pdf
• http://dfgm.math.msu.su/files/ivanov-tuzhilin/Lecture_Notes.pdf
• http://dfgm.math.msu.su/files/0articles/Ilyutko/ilyutko-JKTR.pdf

Welcome to Fourmilab 's calendar converter! ... In the Julian calendar every fourth year is a leap year in which February has 29, not 28 days, but in the Gregorian, years divisible by 100 are not leap years unless they are also divisible by 400. ... The average length of a year is 365.2468 days compared to the actual solar tropical year (time from equinox to equinox) of 365.24219 days, so the calendar accumulates one day of error with respect to the solar year every 216 years. ... Excel serial day: . ...

Еще в разделе: (Показать все результаты (>18) - sbmg.geol.msu.ru/ )

• Ф-502
• Список элементов HTML
• Абсарокит

Revised: 21 May 2014, Accepted: 27 May 2014, Published online in Wiley Online Library (wileyonlinelibrary.com) DOI: 10.1002/jmr.2399 Force -induced globule-coil transition in laminin binding protein and its role for viral- cell membrane fusion Boris N. Zaitseva, Fabrizio Benedettib,e, Andrey G. Mikhaylovb, Denis V. Korneeva, Sergey K. Sekatskiib*, Tanya Karakouzb, Pavel ... 2008, 2010). ... This should permit us to elucidate still unclear aspects of viral-cell membrane interaction and fusion. ...

Еще в разделе: (Показать все результаты (>3) - cell.biophys.msu.ru/ )

... Linguistic expeditions . ... Logical and stylistic aspects of lexical semantics . ... Linguistic phenomena can be approached and described from various perspectives. ... The approach proposed here is distinctive in that it is based on logic and stylistics, which are usually considered marginal to the description of linguistic phenomena. ... A special focus in the present approach on parallel texts is directly connected with translation . ...

Еще в разделе: (Показать все результаты (>25) - lcl.srcc.msu.ru/ )

30 TH I NT E R N AT I ON AL C OSMIC R AY C O N F ER EN C E Search for global asymmetry of UHECR arrival directions with the TUS space detector P. K LI M OV 1 ,O. K AL ASHE V 2 , B . ... Introduction Space-based ultra-high-energy cosmic-ray detectors such as TUS or JEM/EUSO are best suited for searches of the global anisotropies in the distribution of arrival directions of cosmic-ray particles because they provide full-sky coverage with a single experiment. ... Phys. 12, 25 (1999). ... Phys. Lett. ...

Еще в разделе: (Показать все результаты (>3) - cosrad.sinp.msu.ru/ )

• http://cosrad.sinp.msu.ru/experiments/tus/doc/Ponce2007fin.pdf

This document contains frames

Еще в разделе: (Показать все результаты (>31) - shg.phys.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/bmc_genom_2013.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/jbcb_2006.pdf

. Научно-образовательный центр Геномного секвенирования МГУ . Конкурс NGS-проектов ? > ? . Selection . File type icon . File name . Description . Size . Revision . Time . User . ? . polozhenie.pdf . View Download . љ . 30k . v. 2 . Jul 5, 2014, 2:53 AM . Yegor Bazykin . Comments . Sign in | Recent Site Activity | Report Abuse | Print Page | Powered By Google Sites .

Еще в разделе: (Показать все результаты (>5) - genseq.fbb.msu.ru/ )

Annu. ... Key Words stellar energy production, Nobel Prize, supernova, binary pairs s Abstract Astrophysics has been an important part of my personal and scientific life three times. ... Gamov suggested to one of his graduate students, Charles Critchfield, that he actually calculate the proton-proton reaction. ... In stars, the proton-proton reaction is usually followed by a chain of reactions with the end result of producing 4He. ... In 1938, they suggested energy production in stars. ...

Еще в разделе: (Показать все результаты (>292) - astro.uni-altai.ru/ )

• Обзоры препринтов astro-ph