... Dubna & our Venue . ... Dubna branch of the Skobeltsyn Institute of Nuclear Physics, Moscow State University . ... Dubna is located 120 km north of Moscow on the Volga river banks. ... The trains from Moscow to Dubna depart from Savelovsky railway ("Savelovskaya" metro station). there are two railway stations in Dubna: station "Bolshaya Volga" and terminal "Dubna". ... There are two railway stations in Dubna: station "Bolshaya Volga" and terminal station "Dubna". ... from station 'Dubna' . ...

Еще в разделе: (Показать все результаты (>19) - www.elch.chem.msu.ru/ )

• Laboratory of Electrochemical energetics

... These CDD-NDs are produced by specific acid treatment of detonation soot, forming tiny rounded sp2 carbon species (carbon dots), 1­2 atomic layers thick and 1­2 nm in size, covalently attached to the surface of the detonation diamond nanoparticles. ... In this paper, we report that specific acid treatment of NDcontaining detonation soot, produces tiny rounded sp2 carbon species (carbon dots), which are 1­2 atomic layers thick and covalently attached to the surface of DND particles. ... Figure 4. ...

Еще в разделе: (Показать все результаты (>20) - rswater.phys.msu.ru/ )

• http://rswater.phys.msu.ru/en/articles/2014/jalcom.pdf
• http://rswater.phys.msu.ru/Assets/Water/J_Phys_ChemC_2012.pdf

... Магистерское образование . ... Enterprise Information Infrastructure . This course is focused on enterprise infrastructure and integration technology. Course presents different approaches to enterprise architecture and modern solutions of information infrastructure problems. Course?s topics cover strategies that help large enterprises to increase the agility of their IT systems. ... Enterprise portal technology, including collaboration and knowledge management . ... FI- Master data . ...

Еще в разделе: (Показать все результаты (>21) - hcs.cmc.msu.ru/ )

• Master Education | Магистерское и послевузовское образование Entrance
• Mathematical models and methods in VLSI design | Магистерское и послевузовское

... Individual SELEX products, aptamers, are small molecules (40­100 nt) that have a unique three-dimensional structure, which provides for their specific and high-affinity binding to targets varying from low-molecular-weight ligands to proteins. ... Selection of aptamers binding with a target is the key step in SELEX, as aptamers account for only a small fraction of the initial library (one aptamer per 109 to 1013 molecules) [6]. ... Fourth, modification can increase the aptamer affinity for a target. ...

Еще в разделе: (Показать все результаты (>6) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.su/pdfs/article_vas_bioelectro.pdf
• http://rnp-group.genebee.msu.ru/pages/pdf/nar2004.pdf
• http://rnp-group.genebee.msu.su/pdfs/febsz.pdf

Call for Papers International Media Management Academic Association (IMMAA) Annual Conference September 17-18, 2015 Lomonosov Moscow State University, Faculty of Journalism Moscow, Russia Conference website: www.immaa.org About IMMAA IMMAA (International Media Management Academic Association) is the professional grouping of academics worldwide on the subject of media management. ... Like in other academic conferences, extended abstracts and proposals should address the following points: . ... 2015 | ...

Еще в разделе: (Показать все результаты (>38) - www.journ.msu.ru/ )

• Television and Radio Broadcasting :: Department of Journalism, M. V. Lomonosov
• International Media Management Academic Association's (IMMAA) Annual
• A public talk of Professor Nico Carpentier :: Department of Journalism, M. V.

Home Search Collections Journals About Contact us My IOPscience On the Routh sphere problem This content has been downloaded from IOPscience. ... 2013 J. Phys. A: Math. ... It allows us to relate the nonholonomic Routh system with the Hamiltonian system on a cotangent bundle to the sphere with a canonical Poisson structure. ... If the Hamiltonian vector field X has the form (1.4) with respect to the second Poisson bivector, we have the so-called quasi-bi-Hamiltonian system. ... 4 J. Phys. A: Math. ...

Еще в разделе: (Показать все результаты (>115) - ics.org.ru/ )

• http://ics.org.ru/upload/iblock/cfe/194-the-dynamics-of-systems-with-servoconstraints-i_ru.pdf
• http://ics.org.ru/upload/iblock/702/176-the-dynamics-of-a-rigid-body-with-a-sharp-edge-in-contact-with-an-inclined-surface-in-the-presence-o_ru.pdf
• http://ics.org.ru/upload/iblock/c96/169-the-vlasov-kinetic-equation-dynamics-of-continuum-and-turbulence_ru.pdf

... It is shown that theoretical methods developed for description of hopping transport in disordered inorganic solids, such as amorphous semiconductors, can also be successfully applied to description of hopping transport in organic disordered systems, such as conjugated or molecularly doped polymers. We concentrate our discussion on percolation approach and show its universal applicability to systems with different distributions of localized state energies. ...

Еще в разделе: (Показать все результаты (>60) - scon155.phys.msu.su/ )

• EXAFS studies of the interaction of Ge off-center atoms and impurities in GeTe
• Generalized pair approximation in the description of ate AC conductivity of a
• Proceedings of the Fifth Russian-Japanese Symposium on Ferroelectricity

Home . Database of structures of nucleic acid - protein complexes . ... List of complexes . Pfam families . SCOP families . Interaction classes . ... NPIDB . ... Information on SCOP and Pfam domains detected in protein chains is presented. ... Each family has its own web page with the list of entries that include domains of the family. ... List of SCOP domains occurred in DNA-protein and RNA-protein complexes is organized in tree-like form, according to the SCOP classification. ...

Еще в разделе: (Показать все результаты (>90) - npidb.belozersky.msu.ru/ )

... Faculty of Soil Science, Moscow State University . ... Evaluation of acid deposition effects on soils as a component of forest ecosystems. ... Estimation and prediction of forest soil response to acid deposition with simple process-based models. ... Forest soil response to acid deposition, in particular the significance of soil organic matter in the processes of proton consumption, sulphur retention, aluminium and heavy metals mobilisation was investigated. ... Acid Deposition and Forest Soils. ...

Еще в разделе: (Показать все результаты (>25) - eco.soil.msu.ru/ )

• Acid Deposition and Forest Soils. Eds. V.Nikonov G.Koptsik
• Forest ecosystem data in Norwegian-Russian border area
• THEORETICAL PRINCIPLES AND METHODS OF REMEDIATION OF SOILS POLLUTED WITH HEAVY

... Effect of mutations in the beta5-beta7 loop on the structure and properties of human small heat shock protein HSP22 (HspB8, H11). ... Because conservative Lys residues located in the beta5-beta7 loop and in the beta7 strand appear to play an important role in the structure and properties of HSP22, mutations in this part of the small heat shock protein molecule might have a deleterious effect and often correlate with the development of different congenital diseases. ...

Еще в разделе: (Показать все результаты (>62) - biochem.bio.msu.ru/ )

• Seasonal changes in microsomal fraction enriched with Na,K-ATPase from kidneys
• Low Concentrations of Hydrogen Peroxide Activate the Antioxidant Defense System
• Cardioprotective effect of histidine-containing dipeptides in pharmacological

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/bmc_genom2_2013.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/batmas30.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf

Cell Calcium 50 (2011) 211­221 Contents lists available at ScienceDirect Cell Calcium j ourna l ho me page: www.elsevier.com/locate/ceca Review Calcium and cell death mechanisms: A perspective from the cell death community Boris Zhivotovsky a b a,b, , Sten Orrenius a Institute of Environmental Medicine, Division of Toxicology, Karolinska Institutet ... Ca2+ signaling has long been known to be critically involved in both the initiation and effectuation of cell death. ... Cell Biol. ...

Еще в разделе: (Показать все результаты (>6) - www.fbm.msu.ru/ )

Oceanology, Vol. ... MARINE BIOLOGY A Comparative Study of the Primary Production in the Norwegian Sea by Different Methods V. V. Sapozhnikov*, V. B. Goryunova*, B. A. Levenko**, L. E. Dulova***, T. K. Antal**, and D. N. Matorin** * All-Russia Research ... Microbiology, Russian Academy of Sciences, Moscow, Russia Received December 1, 1998; in final form, March 1, 1999 Abstract--The results of primary production measurements obtained by different methods are presented ... OCEANOLOGY Vol. ...

Еще в разделе: (Показать все результаты (>35) - library.biophys.msu.ru/ )

• http://library.biophys.msu.ru/PDF/3340.pdf
• http://library.biophys.msu.ru/PDF/3345.pdf
• http://library.biophys.msu.ru/matorin/3413.pdf

... International Relations in Context of Global Processes - 17| ... GLOBAL ECONOMIC AND POLITICAL TRENDS Prof. Olga Y. Kornienko Economic literature survey Week 1 (4 academic hours ) 1) Current trends of global economy Week 2 (4 academic hours ) 2) Migration, population and globalization Week 3 (4 academic hours ) 3) Corporate culture and management: new trends Week 4 (4 academic hours ) 4) Development markets in global environment Week 5 (4 academic ... Models of the global world. ...

Еще в разделе: (Показать все результаты (>86) - fgp.msu.ru/ )