Application of the V--Ray Technology for Optimization of the TRFD and FLO52 Perfect Club Benchmarks to CRAY Y--MP and CRAY T3D Supercomputers Alexander S. Antonov, Vladimir V. Voevodin Moscow State University, Russia eґmail: voevodin@vvv.srcc.msu.su Abstract The paper shows an application of the soґcalled Vґ Ray Technology for optimizing the TRFD and FLO52 Perfect Club Benchmarks to CRAY Y--MP and CRAY T3D supercomputers. ... Results for CRAY YґMP supercomputers. al structure of the program. ...

Еще в разделе: (Показать все результаты (>8) - asa.guru.ru/ )

ISSN 0026-2617, Microbiology, 2008, Vol. ... Key words: late stationary phase, secondary growth, Pseudomonas aeruginosa, S and M dissociants, population structure of the culture. ... Growth dynamics and population composition of a mixed culture of P. aeruginosa S and M dissociants in the variant of autolysis in the late stationary phase: optical density, OD з 100 (1); ratio of the M dissociant in the population, % (2); pH (3); and content of reducing sugars, mg % (as glucose) (4). ...

Еще в разделе: (Показать все результаты (>5) - dis.bio.msu.ru/ )

• http://dis.bio.msu.ru/States/Fursova_Mil'ko_2006_en.pdf

... The factors that play the key role in complex formation are as follows: the rate of protein diffusion to the docking site; long-range electrostatic interactions between protein surfaces, geometric and chemical complementarity of binding areas; molecular mobility at the proteinґprotein interphase, hydrogen bonds, Van der Waals interactions, hydrophobic interactions, and salt bridges. ... Three-dimensional protein molecules are constructed on the basis of data extracted from the Protein Data Bank. ...

Еще в разделе: (Показать все результаты (>16) - www.library.biophys.msu.ru/ )

• http://www.library.biophys.msu.ru/PDF/80522.pdf
• http://www.library.biophys.msu.ru/art004/article.pdf
• Fluorescence induction curves registered from individual microalgae cenobiums

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>12) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/mol_biol_mosk_2006.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/insilicobiol_2003.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf

Home Search Collections Journals About Contact us My IOPscience Garnet composite films with Au particles fabricated by repetitive formation for enhancement of Faraday effect This article has been downloaded from IOPscience. ... The thickness of a Bi : YIG composite film working for enhanced Faraday rotation was examined using an ion milling method. ... Figure 3(a ) shows the relationship between the total thickness of Au films and mean Au diameter for the repetitive formations using 5 and 2 nm films. ...

Еще в разделе: (Показать все результаты (>42) - nanolab.phys.msu.ru/ )

• http://nanolab.phys.msu.ru/sites/default/files/ppur4z-prb78_193102_2008.pdf
• http://nanolab.phys.msu.ru/sites/default/files/physrevlett.108.123901.pdf
• http://nanolab.phys.msu.ru/sites/default/files/jmmm2016_1.pdf

... International Relations in Context of Global Processes - 17| ... GLOBAL ECONOMIC AND POLITICAL TRENDS Prof. Olga Y. Kornienko Economic literature survey Week 1 (4 academic hours ) 1) Current trends of global economy Week 2 (4 academic hours ) 2) Migration, population and globalization Week 3 (4 academic hours ) 3) Corporate culture and management: new trends Week 4 (4 academic hours ) 4) Development markets in global environment Week 5 (4 academic ... Models of the global world. ...

Еще в разделе: (Показать все результаты (>44) - fgp.msu.ru/ )

... For full UV energy Euv (erg) radiated in TLE the corresponding number of photons of wavelength =300-400 nm (with average energy 3.5 eV) is: Nph=Euv/3.5в1.6 10-12 (1) We considered 2 options of the pinhole camera focal distance: 1. focal distance is short so that the circle of diameter 40 km is observed by one pixel and 2. focal distance is long so that the 40 km circle is observed in many camera pixels. ... Full energy released in UV in the atmosphere is determined by the pixel signal. ...

Еще в разделе: (Показать все результаты (>3) - cosrad.sinp.msu.ru/ )

• http://cosrad.sinp.msu.ru/experiments/tus/doc/HO2COSPAR2006.pdf
• http://cosrad.sinp.msu.ru/experiments/tus/doc/global2007.pdf

... A new mechanism governing the dynamics of territory changing between groups of people such as countries is proposed based on trading with approval of both sides under particular voting rule (veto rule, majority rule, etc.) ... A state equation is obtained based on particular personal utility function. ... The countries which have approximately the same marginal 4 utility of the territory at the border would fight rather than trade as a result of equilibrium in the corresponding game. ...

Еще в разделе: (Показать все результаты (>9) - belyakov.imec.msu.ru/ )

. Name . Last modified . Size . Description . about_center/ . 14-Sep-2013 14:31 . - . sections/ . 31-Oct-2007 14:46 . - . Apache/2.2.16 (Debian) Server at educenter.sinp.msu.ru Port 80

Еще в разделе: (Показать все результаты (>9) - educenter.sinp.msu.ru/ )

... QED n = |G| . ... B] Ken Brown, Mathematics 4340, When are all groups of order n cyclic? ... http://olympiads.mccme.ru/lktg/2011/6/index.htm WHEN ANY GROUP OF N ELEMENTS IS CYCLIC? ... Thus |G| is divisible by m. QED A maximal subgroup of a group is a maximal by inclusion subgroup not coinciding with G and containing more than one element. ... 1) Any maximal subgroup F contains the center Z = Z (G) := {a G : g a = ag for any g G}, i.e., the set of elements commuting with each element of the group. ...

Еще в разделе: (Показать все результаты (>17) - halgebra.math.msu.su/ )

• staff:guterman:publ_engl.html | Кафедра высшей алгебры
• staff:arzhantsev_publications | Кафедра высшей алгебры

... Wiki-синтаксис . ... Ссылки | ... Вы находитесь здесь: МГУ Wiki Синтаксис форматирования . ... Синтаксис форматирования . ... Заголовок 3-го уровня . ... Wiki использует простой язык разметки. ... Wiki позволяет делать текст жирным , курсивным , подчеркнутым или выводить моноширинным шрифтом. ... Совместив синтаксис ссылки и изображения, можно вставить в текст картинку, которая будет внутренней или внешней ссылкой: [[http://www.msunews.ru/wiki/|{{wiki:wiki.png}}]] . ... Ряд 1 Колонка 1 . ...

Еще в разделе: (Показать все результаты (>23) - www.msunews.ru/ )

A project of laser electron X-ray generator for scientific applications I.A. Artyukov, E.G. Bessonov, A.V. Vinogradov, M.V. Gorbunkov, Yu.Ya. ... The possibility of the creation and the application prospects of the laser-electron X-ray generator based on Thompson scattering of laser radiation on a bunch of relativistic electrons are considered. ... It allows viewing collision of electrons with laser photons as the classical Thomson scattering. ... A project of X-ray laser-electron generator [7]. ...

Еще в разделе: (Показать все результаты (>5) - miles.sinp.msu.ru/ )

... MSU Chamber Orchestra . ... Chamber Orchestra of Moscow State University was born in 1967. ... It was originally formed as a chamber orchestra at the School of Mathematics and Mechanics but soon (since September 1967) transformed into a Chamber Orchestra of the Moscow State University. ... The Chamber Orchestra of Moscow State University won the first prizes in the 1-st and 2-nd All-Union festivals of non-professional arts. ... Moscow State University does not have its own School of Music. ...

Еще в разделе: (Показать все результаты (>12) - music.genebee.msu.ru/ )