30 TH I NT E R N AT I ON AL C OSMIC R AY C O N F ER EN C E Search for global asymmetry of UHECR arrival directions with the TUS space detector P. K LI M OV 1 ,O. K AL ASHE V 2 , B . ... Introduction Space-based ultra-high-energy cosmic-ray detectors such as TUS or JEM/EUSO are best suited for searches of the global anisotropies in the distribution of arrival directions of cosmic-ray particles because they provide full-sky coverage with a single experiment. ... Phys. 12, 25 (1999). ... Phys. Lett. ...
[
Текст
]
Ссылки http://cosrad.sinp.msu.ru/experiments/tus/doc/global2007.pdf -- 136.8 Кб -- 19.03.2008 Похожие документы
О кафедре . ... Наглядная и компью терная геометрия и топология . ... Г.В.Носовский. ... Математические заметки, т. 33, вып. 2, 1985, с. 325-333. ... Об условиях, возникающих при оценке производных решений стохастических дифференциальных уравнений в римановых пространствах.. ... Тезисы Бакинской международной конференции по топологии и ее приложениям. ... В.В.Калашников, Г.В.Носовский, А.Т.Фоменко. ... Г.В.Носовский, А.Т.Фоменко. ... Вып. ... А.А.Голованов, Д.П.Ильютко, Г.В.Носовский, А.Т.Фоменко. ...
Studying at MU Programs and degrees . ... Moscow State University provides a wide range educational services and educational programmes. ... International students are offered Bachelour (4 years full time) and Master programmes (2 years full time). A number of our faculties train both domestic and international students according to Bachelour and Master programmes with granting Bachelour and Master diplomas. ... Please, contact International Students Office for information on the topics offered. ...
... Borexino . ... SCIENCE AND TECHNOLOGY OF BOREXINO: A REAL TIME DETECTOR FOR LOW ENERGY SOLAR NEUTRINOS (pdf) . Solar neutrino experiments and Borexino perspectives (pdf) . Detection of Supernova Neutrinos by Neutrino-Proton Elastic Scattering (pdf) . BOREXINO: A REAL TIME LIQUID SCINTILLATOR DETECTOR FOR LOW ENERGY SOLAR NEUTRINO STUDY (pdf) . Confronting Spin Flavor Solutions of the Solar Neutrino Problem with current and future solar neutrino data (pdf) . ... CAN 2.0 стандарт (pdf) . ...
... M.V.Lomonosov Moscow State University Department of Physics, . ... 5-th All-Russian Conference . Nitrides of gallium, indium and aluminum: structures and devices " . ... Four All-Russian Conferences "Nitrides of Gallium, Indium and Aluminum: structures and devices" took place in Russia during 2001-2005 (in Moscow and St.-Petersburg). The conferences enjoyed the support from RFBR and the Ministry of Industry and Science. ... Nitrides of Gallium, Indium and Aluminum: structures and devices". ...
Список вопросов утвержден на заседании кафедры философии естественных факультетов философского факультета Протокол ? 13 от 19 июня 2014 г. ИСТОРИЯ И ФИЛОСОФИЯ НАУКИ (ОБЩАЯ ЧАСТЬ) Вопросы кандидатского экзамена (апрель - май 2015) Лекторы проф. О.Д. Волкогонова и доц. В.А. Шапошников Часть I (Обзор истории науки) 1. ... Кузнецова Н.И. Проблема возникновения науки // Философия и методология науки / Под ред. ... М., 1996. ... Поппер К. Нормальная наука и опасности, связанные с ней // Философия науки. ...
[
Текст
]
Ссылки http://aspirant.phys.msu.ru/qualifying_examination/filosofia/ekzamen_may_2015.doc -- 53.0 Кб -- 04.09.2015 Похожие документы
... The philosophical consequences of synergetics, the interdisciplinary theory of evolution and self-organization of complex systems, are being drawn in the paper. ... Key words: complex systems, evolution, nonlinearity, pre-determination, self-organization, soft management, structure-attractors, synergetics 1. ... The spectra of possible, `allowed' structures correspond to sets of the eigenfunctions of the nonlinear equations describing the evolutionary processes in the complex system. ...
[
Текст
]
Ссылки http://www.students.chemport.ru/materials/Philosophy/orph.pdf -- 61.0 Кб -- 15.01.2009 Похожие документы
... April 9, 1999 . WR 104: Pinwheel Star . ... Explanation: Like a cosmic lawn sprinkler, dust streaming from a rotating star system creates a pinwheel pattern in this false color infrared image . Astronomers discovered the surprising star dust scenario using a sophisticated interferometer and the 10 meter Keck I telescope to observe the bright Wolf-Rayet star WR 104. ... The problem is, their starlight would also be so intense that any dust flakes should be destroyed! ... About APOD > . ...
... Проводится запись на очные курсы СУНЦ МГУ на 2011-12 учебный год . ... ФМШ.ру - обучение одаренных детей . ... СУНЦ МГУ школа им. А.Н.Колмогорова . ...
The Ecological Cooperation Project is the first large-scale children's network project in Russia. This project was founded on the principles of development and achievement of widespread nature awareness among Russian school children through the establishment and unification of numerous childrenтАЩs ecological projects. ... Nature Protected Areas . ... The Project is open for cooperative learning, and any childrenтАЩs ecological organization or group is welcome to participate. ...
... MATHEMATICAL AND SYSTEM BIOLOGY UDC 577.1 Membrane Profile-Based Probabilistic Method for Predicting Transmembrane Segments via Multiple Protein Sequence Alignment R. A. Sutormina and A. A. Mironova a b , b, c State Research Center GosNIIgenetika, Moscow, 117545 Russia; e-mail: sutor_ra@mail ... Bioinformatics, Moscow State University, Moscow, 119992 Russia Received January 25, 2006 Abstract--Prediction of transmembrane (TM) segments of amino ... Protein Sci. ... Proteins. ...
[
Текст
]
Ссылки http://storage.bioinf.fbb.msu.ru/~roman/mol_biol_mosk_2006.pdf -- 151.6 Кб -- 25.05.2006 Похожие документы
... About CIE MSU . ... For Teachers . ... Vestnik CIE (in Russian) . ... Center For International Education . ... Homepage > About Center for International Education > . Our Staff . ... Research areas: methodology of teaching major subjects (mathematics) in Russian to foreign students . ... Research areas: methodology of teaching Russian as a foreign language; linguistic testing . ... Research areas: methodology of teaching Russian as a foreign language; psycholinguistics; linguistic testing . ...
Here are examples of an alignment for input for the program " LCore ". ... 1NK2 (TGTGTCAAGTGGCTGT):A.P/1 (ACAGCCACTTGACACA):B.P/1 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/1 1NK2 (TGTGTCAAGTGGCTGT):A.P/2 (ACAGCCACTTGACACA):B.P/2 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/2 1NK2 (TGTGTCAAGTGGCTGT):A.P/3 (ACAGCCACTTGACACA):B.P/3 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/3 ...
... Head of the Department of Emission-line Stars and Galaxies of SAI MSU . ... Structure and kinematics of galaxies . ... Strasburg Database . Hubble Telescope Archive . ... CFHT Archive . ... Chinese evolutionary synthesis Yunnan . Korean evolutionary synthesis Yonsei . Evolutionary synthesis database BaSTI . ... Electronic Journal "New Astronomy" . Electronic Astrophysical Journal . Electronic Astronomical Journal . ... Questions and comments send to Olga Sil'chenko olga@sai.msu.su ...
Call for Papers September 26-30, 2016 National Cultural Center "Minsk", Minsk, Belar us ICONO/LAT 2016 Int' l Conference on Coherent and Nonlinear Optics (ICONO 2016) Int' l Conference on Laser s, Applications, and Technologies (LAT 2016) The leading event in the area of quantum electronics, laser physics, photonics and their applications. ... Russia Vladimir Belyi, Stepanov Inst. of Physics, NASB, Belar us ICONO Program Vice-Chairs Yulia Vladimirova, Lomonosov Moscow State Univ., ...
[
Текст
]
Ссылки http://iconolat16.phys.msu.ru/download/icono-lat-2016-fcp-reduced.pdf -- 656.9 Кб -- 29.01.2016 Похожие документы
Партнерская программ CRDF . 2003 Cooperative Grants Program . The U.S. Civilian Research and Development Foundation (CRDF) is pleased to announce a new competition for its Cooperative Grants Program. This program allows joint teams of U.S. and former Soviet Union (FSU) scientists and engineers to apply for one- to two-year support for cooperation in any area of civilian research and development in the natural sciences, mathematics, engineering, and biomedical and behavioral sciences. ...
... Chair of Computer Methods of Physics . Department of Physics, M.V. Lomonosov Moscow State University . Welcome to the website of Chair of Computer Methods in Physics! ... methods of analysis and interpretation of experiments (computing and measurements systems theory) . mathematical methods of image analysis and interpretation . methods of fuzzy and uncertain fuzzy . ... Department of Physics M.V. Lomonosov Moscow State University , Chair of Computer Methods of Physics , 2014 . ...
Форум кафедры биофизики биологического факультета МГУ им. М.В.Ломоносова . ... Семинар сектора информатики и биофизики сложных систем . ... Основная страница семинара: http://www.biophys.msu.ru/rus/science/complex_systems/seminar/ . ... вероятностей и математическая статистика (2 курс) Модели нелинейного мира (МУК) Домашние задания Рабочие семинары Общекафедральный семинар Семинар сектора информатики и биофизики сложных систем Семинар группы биофизики клетки Разное О работе сайта ...