... Выписью он назван потому, что это копия от-рывка из другого документа, грамоты; Память, по назначению - до-кумент, доказывающий право на землю, охраняющий это право, на-поминающий об этом праве местным властям: "А отказную выпись писал с отказных книг, слово в слово церкви Успения Богородицы, что в Сидоровской волости церковной дьячек Фетька Степанов сын Новгородцев. ... Вкладную писал Ивашко Исаков, сын" (1549 г.). ... А на то послуси Степан Иванов Кузнецов да Еким Севастиянов сын. ...
... Библиотека / The Somoninge of Everyman . ... GOD . ... EVERYMAN . ... FELAWSHIP . ... GOODES . ... GOOD DEDES . ... In my glory sholde make his mansion, . ... Where arte thou, Deth, thou mighty messengere? ... Hast thou thy Maker forgete? ... Thy many badde dedes, and good but a fewe, . ... And yet, if thou wilte ete, and drinke, and make good chere, . ... Good Dedes, I praye you helpe me in this nede, . ... Helpe my Good Dedes for my piteous exclamacion! . ... The Good Dedes shall make all sure. ...
русский english MSU of Lomonosov Higher School . of Policy in Culture . and Administration in Humanities (faculty) . ... Faculty in the people . ... The faculty educational programs (? ... Art business ?) give students an opportunity to get fundamental specialized training and become highly qualified specialists in the sphere of administration in sport and culture. ... Higher School of Policy in Culture and Administration in Humanities (faculty Lomonosov Moscow State University) 2016 . ...
... Science Park . ... Academician RAS, Pro-rector Head of Department for Innovation and International Scientific Relations, Lomonosov MSU. ... Academician, Dean of the Faculty of Biology, Lomonosov MSU. Professor, Doctor of Physical and Mathematical Sciences, Dean for Continuing Education, Lomonosov MSU, member of the Expert Council of the Russian Federation WAC. ... Corresponding Member of the Russian Academy of Sciences, Dean of the Faculty of Soil Science, Lomonosov MSU. ... JSC MSU Science Park. ...
... 4X0Q SEQ 1 SLSIIDVASDQNLFQTFIKEWRCKKRFSISLACEKIRDDTLVVGLAVCWG 50 4X0Q STR EE HHHHHHHHHHHHH EEEEEEE TTTT EEEEE 4X0Q REM 4X0Q REM . ... 4X0Q ASG SER A 1824 1 C Coil 360.00 -57.26 187.8 4X0Q ASG LEU A 1825 2 C Coil -144.27 130.51 125.7 4X0Q ASG SER A 1826 3 C Coil -137.29 111.22 63.0 4X0Q ASG ILE A 1827 4 C Coil -147.06 163.78 46.7 4X0Q ASG ILE A 1828 5 E Strand -136.86 117.92 67.1 4X0Q ASG ASP A 1829 6 E Strand -72.17 125.41 50.9 4X0Q ASG VAL A 1830 7 C...
International Maize and Wheat Improvement Center No. ... AFRICA "Maize production is likely to suffer the most due to climate change compared to other crops in Southern Africa," said CIMMYT physiologist Jill Cairns, who presented on CIMMYT work under the CGIAR Research Program on Climate Change, Agriculture and Food Security (CCAFS) at the FAO Agriculture Coordination & Information Forum in Harare, Zimbabwe, on 25 July 2013. ... Policy makers in the seed value chain must be engaged as well. ... 2013. ...
[
Текст
]
Ссылки http://ecfs.msu.ru/sites/default/files/node/publication/15/10/e-informa1855.pdf -- 1250.9 Кб -- 06.10.2015 Похожие документы
... 000, 113 (2010) Printed 21 September 2011 A (MN L TEX style file v2.2) A universal ultraviolet-optical colourcolourmagnitude relation of galaxies I1gor V. Chilingarian1,2, and Ivan Yu. ... Received 2011 Sep 15; in original form 2011 Feb 6 ABSTRACT The bimodal galaxy distribution in the optical colourmagnitude diagram (CMD) comprises a narrow "red sequence" populated mostly by early-type galaxies and a broad "blue cloud" dominated by star-forming systems. ...
... Published: 30 October 2014 . Representative of Argentine "Instituto de energia electrica" visit Faculty of Physics on September 4 2014.љ Guiseppe Ratta љ is the director of Argentine љ Instituto de energia electrica љ from San Juan. He met with the dean of Faculty of Physics of Moscow State University. During the meeting international collaboration and exchange of experience were discussed. ... After the meeting with Sysoev N.N.љ Guiseppe Ratta љvisit Engineering Physics Laboratory. ...
The Department of Talented Youth Affairs and Professional Orientation . ... News . ... Older posts . Newer posts . Posted on 03.06.2014 by admin . ... Dean of the Faculty of Biology, MSU (1973-2003) and the school were devoted to topical areas of basic research in biology and biotechnology of microalgae, new methods of Continue reading . Posted in News | ... 2016 - The Department of Talented Youth Affairs and Professional Orientation ...
ISTITUTO NAZIONALE DI FISICA NUCLEARE Sezione di Genova INFN/TC-06/14 October 17, 2006 A FIBER OPTIC AIR BACKED MANDREL HYDROPHONE TO DETECT HIGH ENERGY HADRONIC SHOWERS IN THE WATER M.Anghinolfi1, A.Calvi3, A.Cotrufo3, M.Ivaldi1, O.Yershova2, F.Parodi1, D.Piombo1, A.Plotnikov2 and L.Repetto3 1) INFN-Sezione di ... UniversitЮ degli Studi di Genova, Dipartimento di Fisica Via Dodecaneso 33, I-16146 Genova, Italy Abstract We have studied the design of an air-backed ...
... В 3 года научилась писать цифры и освоила сложение в пределах первого десятка с помощью пальцев. ... Хаусдорф любил уют, общежитий нету тут, . ... Гор. Думы, который, к счастью, возглавляет физик-математик депутат МГД Г.П.Хованская. ... Окончила школу ?9 г. Симферополя. ... Двое внуков: Павлик (младший) - лучший математик в школе и любит иногда писать стихи , написал сборник 'Начало пути'; Миша (старший) любит физику, электронику и любит рисовать, его рисунки могу передать на выставку. ...
Научная Библиотека . Отдел Обслуживания Физического Факультета МГУ . Cambridge Journal of Economics . ... Capital Markets Law Journal . ... Chemical Biology . ... Clinical & Experimental Allergy . Clinical & Experimental Allergy Reviews . Clinical & Experimental Immunology . Clinical & Experimental Ophthalmology . Clinical and Experimental Dermatology . Clinical and Experimental Optometry . ... Научная Библиотека Физического факультета МГУ имени М. В. Ломоносова . ...
... 2.1. ... CP2 . ... u(x, y ) = x {x = const}. 1.5 ( ). u H(D) , . ... g := exp f . ... f const u const. 1.6 (). u H(C) , u const. u = Re f u M . ... 1 n. , 1 := zj 2 -i xj y , j 1 := zj 2 f := +i xj y fzj dz j . ... Aut(D) D Cn . ... g (z )| = exp L f (z ) = exp Re L f (z ) = exp (u, v ). (54) , , f (D), (u, v ) > . ... 1.1. f (z ) = ctg z . ... 2.1. f (z ) = sin z . ln sin z ) = ctg z = 1 + z (sin z ) = ctg z . ... 1 2 , G 1 Z 2 Z C. , z1 z2 (mod G), z2 z1 - ( ). , z1 z2 C/G. 4.2. , . ...
[
Текст
]
Ссылки http://www.dmvn.mexmat.net/content/ccalculus/complexcalculus-6s-beloshapka.pdf -- 391.6 Кб -- 05.07.2010 Похожие документы
... Приложение А Пример составления реферата на |1| |отчет о НИР |2| ... 5.3.2 Реферат должен содержать: - сведения об объеме отчета, количестве иллюстраций, таблиц, приложений, количестве частей отчета, количестве использованных источников; - перечень ключевых слов; - текст реферата. ... Страницы текста отчета о НИР и включенные в отчет иллюстрации и таблицы должны соответствовать формату А4 по ГОСТ 9327. ... 6.6.9 Оформление таблиц в отчете должно соответствовать ГОСТ 1.5 и ГОСТ 2.105. ... НИР |_ ...
[
Текст
]
Ссылки http://www.fpo.msu.ru/open_files/gost7_32_2001.doc -- 186.5 Кб -- 02.09.2010
[
Текст
]
Ссылки http://fpo.msu.ru/open_files/gost7_32_2001.doc -- 186.5 Кб -- 02.09.2010 Похожие документы
Cell. ... In cells overexpressing MycN, as well as cells in which MycN was switched off, a-TOS stimulated rapid entry of Ca2? into the cytosol, compromised Ca2? buffering capacity of the mitochondria and sensitized them towards mitochondrial permeability transition and subsequent apoptotic cell death. ... 4 Mitochondrial Ca2? accumulation in NB cells with different level of MycN expression. a Accumulation of Ca2? by mitochondria in digitonin-permeabilized MycN(?) cells. ...
... Новости Астрономии и Космонавтики: от ПРАО , от "Звездочета" , от Железнякова , от "Переплета" ; . ... Справочники: Основы астрономии , Небесный путеводитель ; . ... Рейтинг страниц в теме: . ... Оценено и сдано в архив! . ... Отдел исследований Луны и планет (ГАИШ) . ... Институт астрономии РАН . ... ASC Data Processing Department Home Page . ... Отдел астрономии и космонавтики МГДТДиЮ . ... ASC Theoretical Astrophysics Department . ... НАЗАД, В СПИСОК КАТЕГОРИЙ (титульная страница AstroTop-100) . ...