... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>12) - tukachev.flogiston.ru/ )

• Category: Новости

. Subsections . Implementation of QCD Lagrangian . 3-gluon vertex. Quark-gluon interaction. Interaction of ghosts with gluon. 4-gluon interaction. Neutrino as a Majorana fermion . Leptoquarks .

Еще в разделе: (Показать все результаты (>784) - theory.sinp.msu.ru/ )

• fc3:dokuwiki:example [THEP]
• Example: Summation of diagrams and symbolic integration by means of the Reduce

. PQ web form . PQ reduced web form . TALSN GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLQRNHYWKPTINL DKLWSLVPEETREKYVAGNAPSDKAIVLDLLSLGYAKVLGKGRLPEVPIVVKARYVSKEA ERKIKEAGGVIELV .

Еще в разделе: (Показать все результаты (>16) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Geometrical core
• PLANdbAffy: probe-level annotation database for Affymetrix expression

Search: . ... About Trac . ... Previous Revision . Latest Revision . Next Revision . ... Revision Log . View revision: . ... Revision 57:2f62804e21fc , 517 bytes checked in by Daniil Alexeyevsky <me.dendik@тАж>, 5 years ago ( diff ) . Added example snake . ... snake Example . ... Rule 1: chase enemy tail . ... Rule 2: stick to walls . ... Powered by Trac 0.12.5 . ... Visit the Trac open source project at . http://trac.edgewall.org/ ...

Еще в разделе: (Показать все результаты (>1577) - kodomo.cmm.msu.ru/ )

• WikiProcessors тАУ Tanchiki
• examples.zip тАУ Cyclyc Cell Automata

... Algorithm & . Format requirements . Contact us . Gallery of examples . SDPsite was applied to 124 families fron the Pfam database . ...

Еще в разделе: (Показать все результаты (>135) - bioinf.fbb.msu.ru/ )

• Alignment example
• User's guide
• SDPsite - Algorithm Format requirements

Myotis . Uropatagium venation pattern in bats as diagnostic character (by the example of genus Myotis ) . ... By the example of genus Myotis it was shown that venation pattern on uropatagium of bats in some cases can be used as diagnostic character. Venation features on uropatagium allow easy to separate Daubentonв?Ts bat, eastern water bat, big-footed bat, and pond bat from Brandtв?Ts bat, Siberian bat, whiskered bat, and Ikonnikovв?Ts bat. ... Bats]. ... Bats of the Russian Far East]. ...

Еще в разделе: (Показать все результаты (>397) - zmmu.msu.ru/ )

... About lab . ... Online Journal "Computer graphics and multimedia" (in russian) . ... MSU Graphics & Media Lab (Video Group) . Algorithm performs detection and tracking of foreground objects. Each frame of video sequence is subdivided into regions of two types: foreground and background objects. ... The main obstacle for segmentation here is the abundance of highly textured objects and sophisticated character of motion (bus is moving behind the static fence). ... Segmentation result . ...

Еще в разделе: (Показать все результаты (>176) - graphics.cs.msu.ru/ )

• Automatic Binary Segmentation of Moving Objects in Video | Лаборатория
• Removal of subtitles and logo from video | Graphics and Media Lab
• GML Matting | Graphics and Media Lab

... Main Practical Applications Seen At Present Reactor Monitoring · In case of accident and no access into reactor , neutrino detector can follow state of nuclear reactions · Neutrino energy sp ectrum can determine comp osition of fissile materials and so indicate illegal use for b omb materials Geological Studies Search for mineral, fuel dep osits DIFFICULTIES I Neutral Current Detector sees all neutrino typ es I I ... Or consider detectors not resp onding to e/ background, like COUPP...

Еще в разделе: (Показать все результаты (>110) - nuclphys.sinp.msu.ru/ )

... Scorpius in Red and Blue . ... Credit Copyright: John Davis Explanation: Cosmic dust clouds dim the light of background stars. But they also reflect the light of stars nearby. Since bright stars tend to radiate strongly in the blue portion of the visible spectrum, and the interstellar dust scatters blue light more strongly than red, the dusty reflection nebulae tend to be blue. ... Of course, the contrasting red emission nebulae are also caused by the hot stars' energetic radiation. ...

Еще в разделе: (Показать все результаты (>4080) - www.astronet.ru/ )

• Journal "Peremennye Zvezdy"
• The Scale of the Universe: Interactive
• NGC 5307: A Symmetric Planetary Nebula

... Corporate Social Policy as an Approach to Managing the Workforce: Some Examples from U. S. History, . ... Corporate social policy is one of the most significant subjects studied by business historians. To attract workers and maintain sound businesses some Russian entrepreneurs adopted paternalistic social welfare policies, described in several recently published works. ...

Еще в разделе: (Показать все результаты (>48) - hist.msu.ru/ )

• Economic History. Yearbook. 2001

... Query: E. coli K12 tRNA (valV, selC, asnV, leuT, argZ from EMBL entry U00096 ) . ... BLASTN (both) | ... Nhunt . ... BLASTN (optimal): 3.5 s . BLASTN (default): 0.8 s . ... Nhunt: 7 s The program Nhunt surpass all other tested programs in sensitivity. ... Nhunt BLASTN (optimal): 2.9 s . ... Nhunt: 3.7 s BLASTN with default parameters actually cannot find any significant homologues. ... Nhunt-3: 1.7 s BLASTN with default parameters actually cann't find any significant homologues. ...

Еще в разделе: (Показать все результаты (>13) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• ConClus
• Nhunt

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: center China. the example, the but to lik . ... a href=http://celinebagsby.zohosites.com/><b>Celine bags</b></a> I think we have too many things. ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...

Еще в разделе: (Показать все результаты (>1540) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: example, IWC such I is States.
• Экологический Форум - Фундаментальная Экология: shall year June best example,
• Экологический Форум - Фундаментальная Экология: on the will example, refine

. [Назад к основному тексту]

Еще в разделе: (Показать все результаты (>172) - chem.msu.ru/ )

• Entrance Examinations - Preliminary Round
• Entrance Examinations - Main Round
• Gleb B. Sergeev, Kenneth J. Klabunde. Nanochemistry. 2nd edition

Alignment COG1325 . ... It is supported by 29 positions - that's written on the scheme. ... Such are positions number 5 ( leucine opposite isoleucine , valine and methyonine ), 30 ( glutamic acid opposite arginine , glycine and serine ), 51 ( threonine opposite alanine , phenylalanine and serine ), 55 ( phenylalanine opposite leucine , histidine and tyrosine ), 111 ( phenylalanine opposite isoleucine , leucine and valine ), 123 ( valine opposite isoleucine , ...

Еще в разделе: (Показать все результаты (>51) - monkey.belozersky.msu.ru/ )

• SDP home page
• SDPpred
• SCOP famyli:

... Classes and Objects . Next . ... The :: operator is being used for this. class A { function example () { echo I am the original function A:: example (). br \n ; } } class B extends A { function example () { echo I am the redefined function B:: example (). br \n ; A:: example (); } } // there is no object of class A. // this will print // I am the original function A:: example (). br A:: ... There are class functions, but there are no class variables. ...

Еще в разделе: (Показать все результаты (>823) - oit.cmc.msu.ru/ )

• ImageCreate
• Bzip2 Compression Functions
• sprintf

Russian depictives and attributives: the role of the verb Russian secondary predicates can use two different case patterns: the instrumental case or the agreeing case. In this paper we discuss the behavior of the adjective in the position of the secondary predicate and we refer to the patterns of agreement discussed above as depictive constructions (taking the instrumental) and attributive constructions (taking the agreeing case), see the examples (1-2). ... Predicate nouns in Russian. ...

Еще в разделе: (Показать все результаты (>171) - www.philol.msu.ru/ )

• LangueDOC :: Archi :: Alphabet

Online Services | ... Nuclear Wallet Cards" . USA National Nuclear Data Center - NNDC . ... Nuclei Selection: . All nuclei Only even Only odd . ... Decay Type: . decay . ... CDFE Head: Vladimir V. Varlamov . ...

Еще в разделе: (Показать все результаты (>14) - cdfe.sinp.msu.ru/ )

• CDFE => Online Services => Nucleus Ground State Parameters
• CDFE => Online Services => NSR Search Engine
• CDFE provides the major photonuclear databases. Online Services.

... Phys. A25 (2010) 3933 (arXiv:0908.0457 [hep-ph]) A brief reminder AdS/CFT correspondence ­ the conjectured equivalence between a string theory defined on one space and a CFT without gravity defined on conformal boundary of this space. ... At one imposes certain gauge invariant boundary conditions on the fields. Equation of motion for the scalar field Solution independent of usual 4 space-time coordinates where M is identified with the quark mass matrix and with the condensate. ...

Еще в разделе: (Показать все результаты (>105) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/talks2013/QFTHEP_Novikov.pdf
• http://qfthep.sinp.msu.ru/talks2013/QFThep2013_sasaki_.pdf
• http://qfthep.sinp.msu.ru/talks/rep_M_QFTHEP.pdf

Примеры из книги О.Д.Авраамовой . ... 5_2.WRL Повторное использование объектов (лучше смотреть с отмеченной опцией "wireframe rendering" браузера, поскольку сфера находится внутри куба и обычным образом видна не будет) . 6_1.WRL Эллипсоид вращения (пример использования узла Transform) . ... 8_2.WRL Пример иллюстрирует использование вариабельности разных полей узла Material. ... Для того, чтобы пример работал и на вашем локальном диске, не забудьте скопировать файл 12_3.WRL . ...

40. Студенческий форум Физфака МГУ > Каррент мьюзик