1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>5) - storage.bioinf.fbb.msu.ru/ )

... References . ... References to books should include the author's name; year of publication; title; page numbers where appropriate; publisher; place of publication, in the order given in the example below. ... Ramirez, F. J., Marquez, R. A. C., and Mondaca, G.: 1991, The 1877 great tsunami and the rapid local warning network in the coast of Northern Chile - South America, In: Proc. International Conference of Australian Earthquake Engineering Society , Brisbane, Australia, 25-1. ... Information . ...

Еще в разделе: (Показать все результаты (>18) - seac47-2.phys.msu.ru/ )

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>54) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• TRF_2d. Page 3.

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>17) - tukachev.flogiston.ru/ )

• Category: Новости

HTML> . HEAD> . meta http-equive="Content-Type" content="text/html; charset=GB2312"> . META NAME="GENERATOR" Content="Microsoft DHTML Editing Control"> . TITLE></TITLE> . ... BODY> . DIV>hi,</DIV> . DIV>I am now using COMPHEP 4.2. ... DIV> . DIV>for example, 500&lt;sqrt(s)&lt;1000GeV. how should i do that in a batch . ... DIV>Any ideals will be appreciated!< ... DIV>&nbsp;</DIV> . ...

Еще в разделе: (Показать все результаты (>1002) - theory.sinp.msu.ru/ )

• Example: Summation of diagrams and symbolic integration by means of the Reduce
• fc3:dokuwiki:example [THEP]
• Examples

... About Trac . Wiki . ... wiki: WikiFormatting . ... Trac has a built in small and powerful wiki rendering engine. ... Display: . ... and `...` commands not only select a monospace font, but also treat their content as verbatim text, meaning that no further wiki processing is done on this text. ! ... Example: * Item 1 * Item 1.1 * Item 1.1.1 * Item 1.1.2 * Item 1.1.3 * Item 1.2 * Item 2 1. ... Cell 1|| ... Image(wiki:WikiFormatting:picture.gif)]] (referring to attachment on another page) . ...

Еще в разделе: (Показать все результаты (>2314) - kodomo.cmm.msu.ru/ )

• example.snake in snakes тАУ Python Battle
• InterWiki тАУ Tanchiki
• examples.zip тАУ Cyclyc Cell Automata

. PQ web form . PQ reduced web form . TALSN GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLQRNHYWKPTINL DKLWSLVPEETREKYVAGNAPSDKAIVLDLLSLGYAKVLGKGRLPEVPIVVKARYVSKEA ERKIKEAGGVIELV .

Еще в разделе: (Показать все результаты (>16) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Geometrical core
• PLANdbAffy: probe-level annotation database for Affymetrix expression

... Algorithm & . Format requirements . Contact us . Gallery of examples . SDPsite was applied to 124 families fron the Pfam database . ...

Еще в разделе: (Показать все результаты (>134) - bioinf.fbb.msu.ru/ )

• Alignment example
• User's guide
• Input Formats

Title Should Be in Bold, 18-Point Type and Centered, Please Use Title Case Author name(s) [10-point type, centered, bolded] Author affiliation and full address (8-point type, centered, italicized) Author e-mail address: (8-point type, centered, italicized) Abstract: Indent left and right margins 0.5 in. (1.27 cm), justify the paragraph (on both right and left), and use the same font as in the body of the paper. ... 5] Author(s), "Title of paper," in Title of Proceedings, Name(s), ed(s)., ...

Еще в разделе: (Показать все результаты (>6) - iconolat13.phys.msu.ru/ )

Myotis . Uropatagium venation pattern in bats as diagnostic character (by the example of genus Myotis ) . ... By the example of genus Myotis it was shown that venation pattern on uropatagium of bats in some cases can be used as diagnostic character. Venation features on uropatagium allow easy to separate Daubentonв?Ts bat, eastern water bat, big-footed bat, and pond bat from Brandtв?Ts bat, Siberian bat, whiskered bat, and Ikonnikovв?Ts bat. ... Bats]. ... Bats of the Russian Far East]. ...

Еще в разделе: (Показать все результаты (>528) - zmmu.msu.ru/ )

• XIV International Ornithological Conference of North Eurasia: Abstracts
• Index of /files/gallery/untitled folder

opti prop conp title alumina test file end cell 4.7602 4.7602 12.9 frac Al core 0.000000 0. Al shel 0.000000 0. O core 0.306240 0. O shel 0.306240 0. space 167 species Al core 0.043 Al shel 2.957 O core 0.513 O shel -2.513 buckingham Al shel O shel 2409. O shel O shel 25. spring Al 403.98 O 20.53 output xr example1 output marvin example 933 90.000000 90.000000 120.0 000000 000000 000000 000000 0.352160 0.352160 0.250000 0.250000 505 0.2649 0.00 0.0 10.0 410 0.6937 32.32 0.0 12.0 1.mvn

Еще в разделе: (Показать все результаты (>7) - cryst.geol.msu.ru/ )

Title Author Key words The Thirty Years War as a prototype of hybrid wars Bagaeva A.V. hybrid war, hybrid warfare, hybrid threats, the Thirty Years' War The idea of the article is to show that the phenomenon of hybrid war, which confidently entered the scientific and official discourse, has a long history. In author's opinion, the Thirty Years' War in Central Europe can be characterized as one of the first historical examples of hybrid war. Abstract

Еще в разделе: (Показать все результаты (>129) - www.socio.msu.ru/ )

• http://www.socio.msu.ru/vestnik/eng/archive/2015/3/14.pdf
• http://www.socio.msu.ru/vestnik/eng/archive/2015/1/11.pdf
• http://www.socio.msu.ru/vestnik/eng/archive/2015/2/15.pdf

NATO Publishing Unit P.O. Box 17 3300 AA Dordrecht A U T H O R 'S D A T A B A S E E N T R Y S H E E T (to be submitted together with the scientific paper ) REFERENCE: ARW978587 TITLE OF THE NATO MEETING/ NATO ASI SERIES VOLUME : Use of Humic Substances to Remediate Polluted Environments: from Theory to Practice NAME OF THE DIRECTOR: Dr. Norbert ... The total space available for keywords and abstract of your paper is 900 characters (approx. 100 words). ...

Еще в разделе: (Показать все результаты (>74) - mgumus.chem.msu.ru/ )

... Corporate Social Policy as an Approach to Managing the Workforce: Some Examples from U. S. History, . ... Corporate social policy is one of the most significant subjects studied by business historians. To attract workers and maintain sound businesses some Russian entrepreneurs adopted paternalistic social welfare policies, described in several recently published works. ...

Еще в разделе: (Показать все результаты (>75) - hist.msu.ru/ )

library(ape) pdf("../example_tree1.pdf", height=2, width=2) plot(read.tree(file="example_tree1.phy"), type="c", direction="u", no.margin=T, label.offset=.1) dev.off() pdf("../example_tree2.pdf", height=2, width=2) plot(read.tree(file="example_tree2.phy"), type="c", direction="u", no.margin=T, label.offset=.1) dev.off() pdf("../example_tree1h.pdf", height=2, width=2) plot(read.tree(file="example_tree1.phy"), no.margin=T, label.offset=.1) dev.off()

Еще в разделе: (Показать все результаты (>260) - herba.msu.ru/ )

• Handwritings (MW)
• INTERNATIONAL SYMPOSIUM
• Untitled Document

Russian Language Training via INTERNET. Internet-based educational hypertexts: some results of formal approach. ... Comparative study of Internet-based educational curricula in Russian Phonetics was based upon formal criteria and objective evidence concerning: (1) coincidence of navigational patterns embedded in a web-presentation of course material to main cognitive patterns of students, (2) rate of hypertext optimisation, (3) adjustability to different academic syllabuses and educational modes. ...

Еще в разделе: (Показать все результаты (>215) - www.philol.msu.ru/ )

• LangueDOC :: Archi :: Alphabet
• Untitled Document

... Query: E. coli K12 tRNA (valV, selC, asnV, leuT, argZ from EMBL entry U00096 ) . ... BLASTN (both) | ... Nhunt . ... BLASTN (optimal): 3.5 s . BLASTN (default): 0.8 s . ... Nhunt: 7 s The program Nhunt surpass all other tested programs in sensitivity. ... Nhunt BLASTN (optimal): 2.9 s . ... Nhunt: 3.7 s BLASTN with default parameters actually cannot find any significant homologues. ... Nhunt-3: 1.7 s BLASTN with default parameters actually cann't find any significant homologues. ...

Еще в разделе: (Показать все результаты (>13) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• ConClus
• Nhunt

Alignment COG1325 . ... It is supported by 29 positions - that's written on the scheme. ... Such are positions number 5 ( leucine opposite isoleucine , valine and methyonine ), 30 ( glutamic acid opposite arginine , glycine and serine ), 51 ( threonine opposite alanine , phenylalanine and serine ), 55 ( phenylalanine opposite leucine , histidine and tyrosine ), 111 ( phenylalanine opposite isoleucine , leucine and valine ), 123 ( valine opposite isoleucine , ...

Еще в разделе: (Показать все результаты (>55) - monkey.belozersky.msu.ru/ )

• SDP home page
• SCOP famyli:
• SCOP famyli: DNA-binding protein LAG-1 (CSL)

. [Назад к основному тексту]

Еще в разделе: (Показать все результаты (>205) - chem.msu.ru/ )

• Entrance Examinations - Preliminary Round
• Entrance Examinations - Main Round
• ===title===

... Fast Facts about the Faculty of Journalism . ... Academic Departments . ... Partners . ... Elena Vartanova became a student of the Faculty of Journalism,љLomonosov Moscow State University in 1976. ... After her graduation with honors, she remained as laboratory assistant at the Department of Foreign Journalism and Literature, Faculty of Journalism.љ ... In 2007, sheљwas appointed as Dean Executive and in 2008 was elected as Dean of theљFaculty of Journalism, Lomonosov Moscow State University. ...

Еще в разделе: (Показать все результаты (>22) - www.journ.msu.ru/ )

• Title :: Факультет журналистики МГУ
• Title