... О UNИX . ... ExportDump . ... Example with --page parameter using regular expression . Output . ... Known limitations "moin export dump" is an HTML export utility to create static HTML dumps of wiki content. ... The --page parameter is optional and will dump pages matching the pagename. ... With the parameter, the output is limited by ACL rules to pages that can be read by the username. ... Note the --page , --target-dir , and --username parameters must follow the export dump parameters. ...

Еще в разделе: (Показать все результаты (>320) - uneex.mithril.cs.msu.su/ )

• HelpOnEditLocks - UNИX
• HelpOnLists - UNИX
• HelpOnPackageInstaller - UNИX

... Download NPG-explorer . ... Build nucleotide pangenome . ... Here we provide a table for 3 Brucella genomes: all: embl :CP002459 BRUMM chr1 c Brucella melitensis M28 chromosome 1 all: embl :CP002460 BRUMM chr2 c Brucella melitensis M28 chromosome 2 all: embl :CP003176 BRUAO chr1 c Brucella abortus A13334 chromosome 1 all: embl :CP003177 BRUAO chr2 c Brucella abortus A13334 chromosome 2 all: embl :CP002078 BRUPB chr1 c Brucella pinnipedialis B2/94 chromosome 1 all: ... Fix bugs....

Еще в разделе: (Показать все результаты (>6955) - mouse.belozersky.msu.ru/ )

• Geometrical core
• Example of alignment
• Alignment example

The term Virtual Host refers to the practice of maintaining more than one server on one machine, as differentiated by their apparent hostname. ... Apache was one of the first servers to support IP-based virtual hosts right out of the box. ... Below is a list of documentation pages which explain all details of virtual host support in Apache version 1.3 and later. ... IP-based Virtual Hosts . ... Folks trying to debug their virtual host configuration may find the Apache -S command line switch useful. ...

Еще в разделе: (Показать все результаты (>110) - neptun.sai.msu.ru/ )

• Apache module mod_example
• Apache module mod_auth_anon.c
• Apache module mod_vhost_alias

... Alignment Sequence . Include picture . No Picture Only Structure Structure and BP numbers Structure and Stem Energy Full Picture . Sequence name . Alignment OR sequence (without name). The usage of Alignment is strongly recommended. Alignment example: . ... ANMF CGCGGGGTAGAGCAGCCTGGTAGCTCGTCGGGCTCATA AQTRNF GCC-AGGATAGCTCAGTTGGTAGAGCAGAGGACTGAAA BGTRF GCC-AGGATAGCTCAGTTGGTAGAGCAGAGGACTGAAT ANMF ATCCTCTCCCCGCC---- AQTRNF ATCCGCCTCCCGGCACCA BGTRF ATCCGCCTCCCGGCACCA . ...

Еще в разделе: (Показать все результаты (>152) - www.genebee.msu.ru/ )

• Screening by similarity
• BLAST Frequently Asked Questions (FAQ)
• screening by keywords

... Given package is a set of special commands and their handler - JOB program. The command aimed for description of often performed operations with files of PC-GAMESS program (dat, out, pun). ... Commands allow running calculation, performing other programs, data change between files and modification of files. ... Command inserts specified group in file.inp. ... del_g h2o.dat |Command deletes all repetition of| |$basis |specified group in file.inp. ... Command changes contents of group on specified | ...

Еще в разделе: (Показать все результаты (>67) - classic.chem.msu.su/ )

• PC GAMESS/Firefly DOCUMENTATION - running in parallel using LAM/MPI
• Lesson 3: two methods for preparing Firefly' input files with basis sets and
• Firefly for Mac OS X: main page

. [ Войти ] . Главная -> Фильмы -> Mr. Fix It . Пользователи . Демо . Деньги . Фильмы . Форум . Mr. Fix It . США 2006 . отметить . Мелодрама . Комедия .

Еще в разделе: (Показать все результаты (>636) - kinfo.ru/ )

• The Big Fix - Фильмы - Kinfo.ru
• Fix - Фильмы - Kinfo.ru
• Ron White: You Can't Fix Stu.. - Фильмы - Kinfo.ru

... About lab . ... Online Journal "Computer graphics and multimedia" (in russian) . ... This is a modification of the original Camera Calibration Toolbox for Matlab by Jean-Yves Bouguet that adds automatic calibration object detection to the functions of the original toolbox. ... The source code can be downloaded lower in this page. v0.31b Download GML Matlab Camera Calibration Toolbox 0.31 11.05.2005 Re-compiled and added correct OpenCV dlls . ... C++ Camera Calibration Toolbox . ...

Еще в разделе: (Показать все результаты (>186) - graphics.cs.msu.ru/ )

• Removing of blocking effect from video | Graphics and Media Lab
• Removing of blocking effect from video | Лаборатория компьютерной графики и
• GML MatLab Camera Calibration Toolbox | Лаборатория компьютерной графики и

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Anonymous . ... Продам Мегафон FIX . ... Re: Продам Мегафон FIX [ re: Anonymous ] . ... Re: Продам Мегафон FIX [ re: Dmitriy_Fox ] . ... Re: Продам Мегафон FIX [ re: Alya ] . ...

Еще в разделе: (Показать все результаты (>3656) - www.fds-net.ru/ )

• Куплю тариф FIX - Public forum of MSU united student networks
• Продам FIX - Public forum of MSU united student networks
• Тариф FIX в аренду - Public forum of MSU united student networks

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Куплю симку тарифа Fix (Мегафон) . ... Re: Куплю симку тарифа Fix (Мегафон) [ re: aniri ] . ... Re: Куплю симку тарифа Fix (Мегафон) [ re: Sobaka_Pavlova ] . ...

Еще в разделе: (Показать все результаты (>2159) - www.snto-msu.net/ )

• Продам Мегафон FIX - Public forum of MSU united student networks
• Куплю тариф FIX - Public forum of MSU united student networks
• Продам симку Megafon FIX - Public forum of MSU united student networks

... The given course consisting of lectures and seminars is aimed at teaching our students a whole range of measures, which allow quick and efficient faultfinding, functional testing, reliability testing of a device, find replacement for a faulty component at the modern technological level, fix a device, create a similar device even without the blueprints. ... Programming an unknown board on TestVue Software . ... Functional testing of an unknown board; comparison with the pattern . ...

Еще в разделе: (Показать все результаты (>8) - engineering.phys.msu.ru/ )

... License . ... This program is free software: you can redistribute it and/or modify . it under the terms of the GNU General Public License as published by . the Free Software Foundation, either version 3 of the License, or . ... This program is distributed in the hope that it will be useful, . ... GNU General Public License GNU General Public License for more details. ...

Еще в разделе: (Показать все результаты (>13) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• ConClus
• Nhunt

... public class ExtensionFileFilter . ... A convenience implementation of FileFilter that filters out all files except for those type extensions that it knows about. ... Extension - create a new filter that filerts out all files but gif and jpg image files: JFileChooser chooser = new JFileChooser(); ExtensionFileFilter filter = new ExtensionFileFilter( new String{"gif", "jpg"}, "JPEG GIF Images") chooser.addChoosableFileFilter(filter); chooser.showOpenDialog(this); . ... private java.lang.String . ...

Еще в разделе: (Показать все результаты (>150) - angel.cs.msu.su/ )

• Appendix B File Format Specification

To restore events from the events_ N file the user should use the . COPMHEP/genEvents command. ... The first instruction should contain an event file name, say, event_1 . ... COMPHEP/genEvents < user_input_file . ... After that the genEvents program writes down the weighted events in the standard output. ... If events are written down in some file they may be mixed up by means of the $COMPHEP/randomize program. The first argument of this function is a name of the file where events are stored. ...

Еще в разделе: (Показать все результаты (>1297) - theory.sinp.msu.ru/ )

• Structure of LanHEP input file
• Examples
• fc3:dokuwiki:example [THEP]

fitshdr - FITS-file headers manipulation tool fitshdr [options] [FITSfile_name] . ... fitshdr [options] --edit FITSfile_name . ... If You want to modify headers of FITSFILE using new FITS-header lines from HEADER file (or from stdin), You have to use this option (You can skip this option, if -H or --header option is used). ... Empty header lines are not displayed (in 'dump' mode only). --line-offsets . ... In 'dump' mode: file offset will be displayed for each header line. --no-line-offsets . ...

Еще в разделе: (Показать все результаты (>147) - lnfm1.sai.msu.ru/ )

• FITShdr: INSTALL

... The main problem is increasing the recognition rate of some recognition engines, working in some restricted domains, such as telephone time-table question-answer systems and so on. ... Our algorithms allow user to get recognition variants, which are right sentences in some formal language. ... We suppose that BRE can produce a set of recognition variants in the form of the "complex chain". ... Length of complex chain is the number of vertexes in its graph. ... const*n^2 . ...

Еще в разделе: (Показать все результаты (>48) - www.intsys.msu.ru/ )

... Полная версия этой страницы: Каррент мьюзик . Студенческий форум Физфака МГУ > Общий > ТРЕП > Карренты . ... This is added while posting a message via http://webwarper.net to avoid misuse of WebWarper. Example of using WebWarper: /ww/~av/lycos.com ] . ... Example of using WebWarper: http://www.webwarper.net/ww/~av/forum.dubi...hp?showforum=42 ] . ... I tear my heart open, I sew myself shut . ... I tear my heart open just to feel . ... And I left my heart open . ...

Еще в разделе: (Показать все результаты (>1018) - wasp.phys.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>8) - storage.bioinf.fbb.msu.ru/ )

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . ... Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: on the will example, refine wealth, the a . ... a href=http://celineforyou.zohosites.com/><b>Celine bags</b></a> As we all know, buy things online maybe cheaper than absolute shopping, so abounding women like online shopping. ... http://www.isabelmarantmybest.com . ...

Еще в разделе: (Показать все результаты (>3991) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: example, IWC such I is States.
• Экологический Форум - Фундаментальная Экология: example, the are around PRADA,
• Экологический Форум - Фундаментальная Экология: center China. the example, the

download:rn-031116 ]] . CompHEP . ... Documentation and help files . ... New scheme of work with initial beams and final composite particles was changed. If you have a private model and want to use them with CompHEP-4.4.0, you have to copy cpart1.mdl file to cpartN.mdl file where N is a number of your model by commands: cd path_to_user_working_directory/model cp cpart1.mdl cpartN.mdl . All new composite particles must be introduce into table by using edit model facilities. ... Downloads . ...

Еще в разделе: (Показать все результаты (>19) - comphep.sinp.msu.ru/ )

• extra:main [CompHEP]

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>17) - tukachev.flogiston.ru/ )

• Category: Новости