Sandbox test area with all features enabled. ... Sandbox ? PluginTestJQueryPlugin . Dialog . ... Spinner . ... Create Dialog Close . I have a title and I'm big . ... Start spinner Stop . Start big spinner Stop . Start fast spinner Stop . Start big fast spinner Stop . ... Copyright &© by the contributing authors. All material on this collaboration platform is the property of the contributing authors. Ideas, requests, problems regarding TWiki? ...

Еще в разделе: (Показать все результаты (>35092) - dualopt1.cmm.msu.ru/ )

• PluginTestJQueryPlugin - Sandbox - TWiki - (printable)
• %TOPICTITLE% ( vs. 1) - TWiki
• %TOPICTITLE% (search) - TWiki

... PHP 3 <= 3.0.18, PHP 4 >= 4.0.0) mysql_close -- Close MySQL connection . bool mysql_close ( [resource link_identifier]) . Returns TRUE on success, FALSE on failure. mysql_close() closes the connection to the MySQL server that's associated with the specified link identifier. If link_identifier isn't specified, the last opened link is used. ... php $link = mysql_connect("kraemer", "marliesle", "secret") or exit("Could not connect"); print ("Connected successfully"); mysql_close($link); ?> ...

Еще в разделе: (Показать все результаты (>410) - oit.cmc.msu.ru/ )

• pg_close
• mssql_close
• ifx_close

. General Information . Media Files . Participants . Timetable . Local Information . Photos . Sorry, the registration is closed.

Еще в разделе: (Показать все результаты (>10) - site2010.sai.msu.ru/ )

• General information
• Closing of conference

. Помощь - Поиск - Пользователи - Календарь . Полная версия: Closed . Грация-МГУ::Форум > Дискуссии > Танцевальная жизнь > Товары & услуги . S&L . Jun 4 2011, 04:13 ... Это текстовая версия - только основной контент. Для просмотра полной версии этой страницы, пожалуйста, нажмите сюда .

Еще в разделе: (Показать все результаты (>19) - grace.msu.ru/ )

• Closed - Грация-МГУ::Форум

Dear Polyslavists, The next annual meeting of Polyslav takes place between 25th and 27th of september 2009 in Hamburg. The closing date for submissions is 31 January 2009, so, please fill out the attached application form and send it back to us till January 31rd. ... If You need accomodation in Hamburg, please specify this in the attached application form so that we are able to make reservations in time. ... Registration for POLYSLAV XIII Hamburg, 25th-27th september 2009 |1. | ... need | ...

Еще в разделе: (Показать все результаты (>330) - www.philol.msu.ru/ )

• http://www.philol.msu.ru/~rkigf/P_Objavlenija/Konferencii/Konferencii_2009/2009_9_Ostrava_ENG-info-poster-COK4.pdf
• http://www.philol.msu.ru/~rkigf/P_Objavlenija/Konferencii/Konferencii_2009/2009_9_Ostrava_ENG-application.doc

. Русский . Home News Program Committee Organizing Committee Program Plenaries Special Sessions Registration Abstracts Accommodation Important dates Contacts Poster Links Conference Venue Video . Registration closed . Conference registration is closed. 2007 2008 Optimal Control Department, . CMC Faculty of Lomonosov MSU .

Еще в разделе: (Показать все результаты (>13) - pont2008.cmc.msu.ru/ )

Wireshark · · · · · (Win, Mac, Linux) Open Source (http://www.wireshark.org) · · · ( ) · 2 1 · # usermod ­a ­G wireshark user · wireshark root user@host:~$telnet ya.ru 80 Trying 213.180.193.3.. ... MAC 2. MAC IP ARP 3. L4 Interface # 1 2 3 4 Domain # 1 1 Eth Address 00:00:00:00:00:0a 00:00:00:00:00:09 IPv4 Address 10.0.1.2 10.0.1.1 10.0.2.2 10.0.0.3 Flow # 1 2 Src Itf # 1:49153 3:49153 Dst Itf # 4:234 1:432 Protocol TCP UDP Edges 1-2 1-2 .. ...

Еще в разделе: (Показать все результаты (>3) - lvk.cs.msu.su/ )

Home Page Top ology on Graphs Title Page Contents Zhi Lu Ё Institute of Mathematics, Fudan University, Shanghai. Page 1 of 22 Osaka, 2006 Go Back Full Screen Close Quit Home Page §1. ... Title Page Contents Page 15 of 22 Go Back Full Screen Close Quit Home Page Basic problem (I) (, ): a coloring graph of type (n, n) with connected. ... Title Page Contents Page 20 of 22 Go Back Full Screen Close Quit Home Page Prop osition. ... Title Page Contents Page 22 of 22 Go Back Full Screen Close Quit ...

Еще в разделе: (Показать все результаты (>126) - higeom.math.msu.su/ )

• Conferences (English)
• INVITED ADDRESSES:
• Old conferences (English)

... Publications . ... Laboratory of Mathematical Methods of Image Processing . ... Diffuse axonal injury lesion segmentation using contouring algorithm . ... This study is devoted to semiautomated segmentation of DAI lesions on T2*-weighted brain magnetic resonance (MR) images. ... A proposed algorithm for automated segmentation of DAI lesions inside specified regions is based on contouring algorithm which treats the image as a 3D topological map where a pixelтАЩs intensity corresponds to its height. ...

Еще в разделе: (Показать все результаты (>655) - imaging.cmc.msu.ru/ )

... Closing a File . ... MPI_FILE_CLOSE(fh) . INOUT fh] file handle (handle) . int MPI_File_close(MPI_File *fh) . MPI_FILE_CLOSE(FH, IERROR) . ... void MPI::File::Close() . MPI_FILE_CLOSE first synchronizes file state (equivalent to performing an MPI_FILE_SYNC), then closes the file associated with fh. ... MPI_FILE_CLOSE is a collective routine. ... The MPI_FILE_CLOSE routine deallocates the file handle object and sets fh to MPI_FILE_NULL. ... MPI-2.0 of July 18, 1997 . ... Центры . ...

Еще в разделе: (Показать все результаты (>187) - www.parallel.ru/ )

• MPE_Close_graphics | PARALLEL.RU - Информационно-аналитический центр по
• MPI_File_close | PARALLEL.RU - Информационно-аналитический центр по
• Opening a File | PARALLEL.RU - Информационно-аналитический центр по

... Краткое название белка ? DEF_ECOLI . Полное название организма ? Escherichia coli , K-12 . Название гена ? def . ... b3287 . DEF_ECOLI MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEG IGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVP RAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVE KLDRLKARA . Аминокислотный состав белка . ... Частота остатка в DEF_ECOLI . ... D (Аспарагиновая кислота) . ... E (Глутаминовая кислота) . ... Андреева Мария, 2004 ...

Еще в разделе: (Показать все результаты (>2261) - kodomo.cmm.msu.ru/ )

• Timeline ? Python Battle
• Available Reports тАУ Python Battle
• Available Reports тАУ Petri Dish

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . ... Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: Each of the Close to working experience . ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . Вы не можете публиковать новые темы в этом форуме . ...

Еще в разделе: (Показать все результаты (>3314) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: Each of the Close to encounter
• Экологический Форум - Фундаментальная Экология: it is vital you close up
• A.N. Severtsov Institute of Ecology and Evolution (IPEE RAS): News: News:

яЛП . id #169 . Heat Transfer - Japanese Research [not defined] . Common information . Periodicy: . [no information] . Impact-Factor: . [no information] . ISSN: . 1520-6556 . In print: . since 1996-01-01 till 1999-12-31 . Language: . en . Price: . single article - $1 . Classifier: . [no at all] . Comment: . From 1999: Heat Tranfer - Asian Research . Published by . (4) . Wiley Interscience - roboUpdate . No homepage defined . No open resources defined . Close . Complain . Edit

Еще в разделе: (Показать все результаты (>1433) - journals.genebee.msu.ru/ )

... For the past years I have been working on the problem of synthesis of light curves of close binary systems, consisting of a normal star and a compact object (point object with fixed X-ray luminosity). ... Possible existence of a bright spot on the disk's lateral surface is taken into account. ... The last of then will be published in Gordon and Breach Publishers ( Cherepashchuk A.M., Katysheva N.A., Khruzina T.S., Shugarov S.Yu. ... Cherepashchuk A.M., Katysheva N.A., Khruzina T.S., Shugarov S.Yu. ...

Еще в разделе: (Показать все результаты (>19) - uranus.sai.msu.ru/ )

• The Database of Close Binary Systems
• Anatol Cherepashchuk
• Igor Antokhin

... 4 from monomer import AminoAcidType . ... 18 """ Sequence of Monomers . ... 21 * name -- str with the name of sequence . ... 24 * pdb_chains -- list of Bio.PDB.Chain's . ... 27 * pdb_residues -- dictionary like {Bio.PDB.Chain: {Monomer: Bio.PDB.Residue}} . ... 42 def __init__ ( self , monomers = None , name = '' , description = "" ): . ... 106 return Sequence ( monomers , name , description ) . ... 189 def pdb_has ( self , chain , monomer ): . ... 192 def secstr_has ( self , chain , monomer ): . ...

Еще в разделе: (Показать все результаты (>14503) - kodomo.fbb.msu.ru/ )

• allpy: 56d62d405021 sandbox/wx-dc.py
• allpy: f3706f0b40ae lib/block.py
• allpy: 56d62d405021 allpy/fileio.py

. September 169 . Mon . Tue . Wed . Thu . Fri . Sat . Sun . 1 . 2 . 3 . 4 . 5 . 6 . 7 . 8 . 9 . 10 . 11 . 12 . 13 . 14 . 15 . 16 . 17 . 18 . 19 . 20 . 21 . 22 . 23 . 24 . 25 . 26 . 27 . 28 . 29 . 30 .

Еще в разделе: (Показать все результаты (>4501) - fmp.msu.ru/ )

. Kudryashov S.I. , Kim B.K. , Zorov N.B. , Kuzyakov Yu.Ya. Book of abstracts of 9th. Int. Symp. on small particles and inorganic clusters (ISSPIC'9, September 1998, Lausanne), p.3.17. Abstract . The chemical composition of the separate laser-evaporated species detected by TOFMS due to their large size is close to the same one of the precursor material (C3N4.2) evaporated. Laboratory of Laser Diagnostics

Еще в разделе: (Показать все результаты (>504) - chem.msu.ru/ )

• Moscow University Chemistry Bulletin Vol. 50, No. 3, P. 169 (2009)
• Moscow University Chemistry Bulletin Vol. 43, No. 4, P. 221 (2002)
• M. Ya. Melnikov, V.A. Smirnov Handbook of Photochemistry of Organic Radicals

... I have been in Moscow on a Fulbright grant since September 2001, teaching at Moscow State University, conducting research on Russian autobiography, and working as the Co-Director of the Center for Russia and the United States. ... State University at Albany. мгу-суни . ...

Еще в разделе: (Показать все результаты (>19) - suny.msu.ru/ )

The QCloseEvent class contains parameters that describe a close event. ... void  accept  ()  . ... Close events are sent to widgets that the user wants to close, usually by choosing "Close" from the window menu. They are also sent when you call QWidget::close () to close a widget from inside the program. Close events contain a special accept flag which tells whether the receiver wants the widget to be closed. ... The event handler QWidget::closeEvent () receives close events. ...

Еще в разделе: (Показать все результаты (>342) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - QPointArray Class
• Qt Toolkit - QBuffer Class
• Qt Toolkit - QFile Class

... Photos . Aspen, view from the riding gondola . ... Colorado, mountains around Aspen . ... The Duluth's drawbridge . ... The Duluth's railroad museum . ... My brother . ...

Еще в разделе: (Показать все результаты (>294) - lnfm1.sai.msu.ru/ )

• Публикации Чепуровой В.М.
• Литература