. PQ web form . PQ reduced web form . TALSN GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLQRNHYWKPTINL DKLWSLVPEETREKYVAGNAPSDKAIVLDLLSLGYAKVLGKGRLPEVPIVVKARYVSKEA ERKIKEAGGVIELV .

Еще в разделе: (Показать все результаты (>386) - mouse.belozersky.msu.ru/ )

• wLake program homepage
• PLANdbAffy: probe-level annotation database for Affymetrix expression
• NPG-explorer

fitshdr - FITS-file headers manipulation tool fitshdr [options] [FITSfile_name] . ... fitshdr [options] --edit FITSfile_name . ... If You want to modify headers of FITSFILE using new FITS-header lines from HEADER file (or from stdin), You have to use this option (You can skip this option, if -H or --header option is used). ... Empty header lines are not displayed (in 'dump' mode only). --line-offsets . ... In 'dump' mode: file offset will be displayed for each header line. --no-line-offsets . ...

Еще в разделе: (Показать все результаты (>388) - lnfm1.sai.msu.ru/ )

• Data bases of Natural Satellites. Documentation. Structure
• Data bases of Natural Satellites. Documentation. Sources

Home . Database of structures of nucleic acid - protein complexes . ... List of complexes . Pfam families . SCOP families . Interaction classes . ... NPIDB . ... Information on SCOP and Pfam domains detected in protein chains is presented. ... Each family has its own web page with the list of entries that include domains of the family. ... List of SCOP domains occurred in DNA-protein and RNA-protein complexes is organized in tree-like form, according to the SCOP classification. ...

Еще в разделе: (Показать все результаты (>92) - npidb.belozersky.msu.ru/ )

... NetCDF User's Guide for C . ... 2 - Components of a NetCDF Dataset . ... 2.4 - Attributes . ... 3.1 - netCDF external data types . ... 7.5 - Write a Single Data Value: nc_put_var1_ type . ... 7.10 - Read a Single Data Value: nc_get_var1_ type . ... 7.12 - Read an Array of Values: nc_get_vara_ type . 7.13 - Read a Subsampled Array of Values: nc_get_vars_ type . 7.14 - Read a Mapped Array of Values: nc_get_varm_ type . ... 7.16 - Fill Values . ... 8.4 - Get Attribute's Values:nc_get_att_ type . ...

Еще в разделе: (Показать все результаты (>125) - angel.cs.msu.su/ )

• Appendix B File Format Specification
• : Class Schema
• : Package ucar.netcdf

... Custom Query . ... Component . ... automata io requirements ui . ... В And В Blocked By Blocking Cc Component Created Description Keywords Milestone Modified Owner Priority Reporter Resolution Status Summary Ticket Type . Or В Blocked By Blocking Cc Component Created Description Keywords Milestone Modified Owner Priority Reporter Resolution Status Summary Ticket Type . ... Summary Component Milestone Status Owner Type Priority Resolution Created Modified Blocked By Blocking Reporter Keywords Cc . ...

Еще в разделе: (Показать все результаты (>488) - kodomo.cmm.msu.su/ )

• Custom Query ? Cyclyc Cell Automata
• snakes (log) тАУ Python Battle

Title , Contents , Index . rtftohtml reads up RTF format documents and translates them to HTML. In processing text, the filter chooses HTML markup based on three characteristics
. ... The paragraph style
. ... For paragraph and text styles, the rules for translation are contained in a file called html-trans
(see Section 5.1 ). ... If a paragraph style is not found, a warning will be generated and the text will be written to the HTML file with no special markup.) ...

Еще в разделе: (Показать все результаты (>572) - comet.sai.msu.ru/ )

• The IMG (Image) Element
• rtftohtml Users Guide - 4 Special Processing
• Definition Lists

... Guidelines for Paper Submission . ... The program committee will schedule both oral and poster sessions. The abstract and summary of both oral and poster papers are published in the same manner in the Conference Program and the Technical Digest on CD-ROM. ... Oral Sessions . ... Poster Sessions . ... For poster sessions, authors are provided with bulletin boards on which to display their papers, along with a sign indicating their paper numbers, and pushтАУpins or adhesive tape. ... Program . ...

Еще в разделе: (Показать все результаты (>5) - iconolat13.phys.msu.ru/ )

О лаборатории . ... Лаборатория теоретической биофизики . ... Here the guide to use RESP technique based on calculations from Firefly or GAMESS-US is presented. ... Note, that RESP algorythm will fit potential in the set of points which are selected according to $PDC group in the input-file. ... Нет комментариев " Using RESP with GAMESS-US and Firefly (PC-GAMESS) " . ... Using Firefly/GAMESS-US efficiently . ... Scannin? in Using Firefly/GAMESS-US efficiently? 2012 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>42) - erg.biophys.msu.ru/ )

• Visualize partial charges in PyMol ERG Research Group: Лаборатория
• Pymol compilation with VMD Molfile plugins ERG Research Group: Лаборатория

... About lab . ... Online Journal "Computer graphics and multimedia" (in russian) . ... Photorealistic rendering used in many spheres such as cinema, architecture design, light design, computer games (light maps) and others. The speed is a central problem of photorealistic rendering. ... That s why, acceleration of photorealistic rendering is very important. ... We develop a system that support followed algorithms: . Backward ray tracing . ... See http://ray-tracing.ru/en for more information. ...

Еще в разделе: (Показать все результаты (>272) - graphics.cs.msu.ru/ )

• Creation of cartoons from video | Graphics and Media Lab
• Creation of cartoons from video | Лаборатория компьютерной графики и...

... mpiman . Starts reader for MPI man pages in Unix man or Web HTML format The mpiman command gives access to the MPI manual pages in both UNIX man and Web HTML format. By default, mpiman uses xman, the X Window System manual browser to read the man pages. ... Use the xmosaic Web browser. -mosaic . Use the mosaic Web browser. xmosaic and mosaic are often the same program . ... Use the netscape Web browser. -xman . Use the X Window System xman Unix man browser . man . ... Центры . ...

Еще в разделе: (Показать все результаты (>484) - www.parallel.ru/ )

• Reserved Keys | PARALLEL.RU - Информационно-аналитический центр по параллельным
• Heterogeneous networks and the ch_p4 device | PARALLEL.RU -
• C++ Binding Issues | PARALLEL.RU - Информационно-аналитический центр по

May 12, 1998 NOTES from May 9, 1998: The format of the Solar Event Lists was changed to include a standard SEC style header. ... Please send comments and suggestions to sec@sec.noaa.gov # # Missing data: //// # # Edited Events for 1998 May 11 # # Event Begin Max End Obs Q Type Loc/Frq Particulars Reg# #------------------------------------------------------------------------------- 2560 A0146 //// 1225 HOL ... The UT day of the event's begin time is the UT day of the list. ...

Еще в разделе: (Показать все результаты (>24) - dbserv.sinp.msu.ru/ )

• Electron Online Data Set Selector
• Proton Online Data Set Selector
• Electrons Online Data Set Selector

. Developed by ValVe . Uses gnuplot v4

Еще в разделе: (Показать все результаты (>2) - depni.sinp.msu.ru/ )

... Example with GPS Positions GPS position acquisitions Coding in Argos Messages Messages collection by satellites Messages relay to CLS GPS position decoding Distributed displayed Data Processing 1 Message n°1 11010101011001 2 3 4 5 F O R M A T R E C O G N I T I O N D A T A E X T R A C T I O N data n°1 Air T°C = 22.5°C Message n°2 00101011101010010 101000000000001 P R O C E S S I N G C O N T R O L S P R O V I S I O N W ind speed = 4 m/s ... Has my platform entered/left an area of interest?...

Еще в разделе: (Показать все результаты (>2849) - www.sevin.ru/ )

• http://www.sevin.ru/ecosys_services/references/Puzachenko_et_all_2011.pdf
• http://www.sevin.ru/ecosys_services/references/Kozlov_Identification_of_geosystems_formative_factors.pdf
• http://www.sevin.ru/news_eng/Krab-06-InfLetter-eng.pdf