... TUS . ... News . ... TUS Ultra high energy cosmic ray detector on-board the Lomonosov satellite . ... Modi?ed KLYPVE is a novel ?uorescence detector of ultra high energy cosmic rays (UHECRs, energies 50EeV) to be installed on the Russian Segment of the International Space Station. ... Two types of orbital detectors of extreme energy cosmic rays are being developed nowadays: (i) TUS and KLYPVE with reflecting optical systems (mirrors) and (ii) JEM-EUSO with high- transmittance Fresnel lenses. ...

Еще в разделе: (Показать все результаты (>39) - uhecr.sinp.msu.ru/ )

• High energy electromagnetic cascades in extragalactic space: physics and
• Publications on Transient luminous events
• Lab's publications

GCVS Research Group: . Recent publications . Kazarovets E.V., Samus N.N., Durlevich O.V., Kireeva N.N., Pastukhova E.N., The 81st Name-List of Variable Stars. ... Kazarovets E.V., Samus N.N., Durlevich O.V., Kireeva N.N., Pastukhova E.N., The 80th Name-List of Variable Stars. ... Samus N.N., Kazarovets E.V., Kireeva N.N., Pastukhova E.N., Durlevich O.V. General Catalogue of Variable Stars: Current status and new Name-lists Odessa Astronomical Publications, 2010, V. 23, p. 102-105. ...

Еще в разделе: (Показать все результаты (>88) - sai.msu.ru/ )

... Russian Pages . CDFE: Home Page . ... Numerical data, graphics, and bibliography . ... description] . Last updated: May 6th, 2014 . ... Last updated: June 15th, 2011 . ... Last updated: . ... Last updated: April 4th, 2015 . ... Last updated: February 25th, 2016 . ... Last updated: September 27th, 2011 . ... Photonuclear Data Index since 1955 . ... Last updated: September 15th, 2015 . ... Last updated: March 22th, 2010 . ... Last updated: March 19th, 2015 . ... Last updated: May 15th, 2002 . ...

Еще в разделе: (Показать все результаты (>44) - cdfe.sinp.msu.ru/ )

• CDFE => Online Services => Relational ENSDF

How do Linux Threads compare with other OSs'? ... Solaris . ... Priority Scheduling [1] . ... Mutex Attributes . ... Thread Attributes . ... Posix and Solaris link thread priorities with mutexes and use the priority of a blocked thread's mutex to alter the priority of the blocking thread. Win32 and Linux let the scheduler determine what thread to elevate in priority. ... Solaris implements it because they need it: the program can change certain thread's attributes unless it is suspended. ...

Еще в разделе: (Показать все результаты (>337) - rtm-cs.sinp.msu.ru/ )

Publications of the Laboratory of Photochemistry . D.N. Dogadkin, M.G. Kuzmin . Kinetic and thermodynamic properties of exciplexes with partial charge transfer. E.V. Dolotova, I.V. Soboleva . Exciplexes with partial electron transfer. ... M.G. Kuzmin . ... I.V. Soboleva . ... I.V. Soboleva, D.N. Dogadkin, M.G. Kuzmin . ... I.V. Soboleva, M.G. Kuzmin, J. van Stam, G. Bhaskar Dutt, F.C. De Schryver . ... O.I. Kutsenok, N.V. Korzakova, D.N. Dogadkin, I.V. Soboleva, M.G. Kuzmin . ...

Еще в разделе: (Показать все результаты (>671) - chem.msu.ru/ )

• Publications of the Laboratory of Kinetics and Catalysis
• Publications of the Laboratory of Organic Synthesis
• Conjunction of thermal lens spectrometry and high-performance liquid

... Query: E. coli K12 tRNA (valV, selC, asnV, leuT, argZ from EMBL entry U00096 ) . ... BLASTN (both) | ... Nhunt . ... BLASTN (optimal): 3.5 s . BLASTN (default): 0.8 s . ... Nhunt: 7 s The program Nhunt surpass all other tested programs in sensitivity. ... Nhunt BLASTN (optimal): 2.9 s . ... Nhunt: 3.7 s BLASTN with default parameters actually cannot find any significant homologues. ... Nhunt-3: 1.7 s BLASTN with default parameters actually cann't find any significant homologues. ...

Еще в разделе: (Показать все результаты (>17) - mouse.genebee.msu.ru/ )

... 20.09.2009 . ... Moscow Vyatichi, November 9 - 11, 2009. ... In this work we study sum-frequency generation from the surface of an isotropic chiral medium in arbitrary interaction geometry of the paraxial light beams at fundamental frequencies. ... Within the first-order approximation approach, generally, the polarization state of light is distributed inhomogeneously in the reflected signal beam cross section, and the transversal intensity distribution is not Gaussian. ... Full publication text . ...

Еще в разделе: (Показать все результаты (>178) - ofvp.phys.msu.ru/ )

... 20.09.2009 . ... Moscow Vyatichi, November 9 - 11, 2009. ... Opt., 2009, v. 11, 074008 . ... In this work we study sum-frequency generation from the surface of an isotropic chiral medium in arbitrary interaction geometry of the paraxial light beams at fundamental frequencies. ... Within the first-order approximation approach, generally, the polarization state of light is distributed inhomogeneously in the reflected signal beam cross section, and the transversal intensity distribution is not Gaussian...

Еще в разделе: (Показать все результаты (>102) - ilc.phys.msu.ru/ )

Application of evolutionary model in the evaluation of the quality of pair wise alignment of amino acid sequences Valery Polyanovsky, V. G. Tumanyan Engelhardt Institute of Molecular Biology, Russian Academy of Sciences, Moscow, 119991 Russia ... : polyanovskyvo@mailfrom.ru, tuman@eimb.ru The purpose of the work is to develop a universal method for estimating the pairwise alignment quality depending on the evolutionary distance (degree of homology) between the ... REFERENCES 1. ...

Еще в разделе: (Показать все результаты (>236) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/106.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/50.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/171.pdf

... 2011 February 22 . Star Size Comparisons . ... Explanation: How big is our Sun compared to other stars? In a dramatic and popular video featured on YouTube , the relative sizes of planets and stars are shown from smallest to largest. ... Note that the true sizes of most stars outside of the Sun and Betelgeuse are not known by direct observation, but rather inferred by measurements of their perceived brightness , temperature , and distance. ... About APOD | ...

Еще в разделе: (Показать все результаты (>2265) - www.sai.msu.su/ )

• APOD: 2013 June 6 - Star Size Comparisons
• SNe related preprints
• SAL- Other Scientific Fields - Chemistry, Biology Related - Evalign

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Войти в систему . ... Ilyash L.V. , Belevich T.A. , Yashina E.V. в журнале IZVESTIYA AKADEMII NAUK SERIYA BIOLOGICHESKAYA , ? ...

Еще в разделе: (Показать все результаты (>1999) - istina.msu.ru/ )

• Compare - журнал | ИСТИНА - Интеллектуальная Система Тематического Исследования
• Odessa Astronomical Publications - журнал | ИСТИНА - Интеллектуальная Система
• Aoki Y. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

... Bashindzhagyan G . ... Panasyuk M . ... Proc.26th ICRC, Salt Lake City , 1999, v.5, p.132-135. Bashindzhagyan G.L., Samsonov G.A., Khein L.A., Panasyuk M.I., . Voronin A.G., Zatsepin V.I., ATIC Collab .. The Advanced Thin Ionization Calorimeter (ATIC) for Studies of High . ... Proc. 26th ICRC, Salt Lake City , 1999, v.5, p.9-12. ... Silicon Matrix Detector for ATIC . ... Proc. 26th ICRC, Salt Lake City , 1999, v.5, p.453-456. ... Advanced Thin Ionization Calorimeter (ATIC) .- ...

Еще в разделе: (Показать все результаты (>26) - silab.sinp.msu.ru/ )

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>161) - www.genebee.msu.ru/ )

• AliComp - GeneBee Alignments Comparison - Advanced
• GeneBee BLAST 2.2.8 Services
• GeneBee BLAST 2.2.22+ Services

... intas:cern-intas03:papers ]] . THEP . ... Show page . ... Both sides previous revision Previous revision . 17/122007 15:53 kryukov 17/122007 15:50 kryukov 17/122007 15:45 kryukov 17/122007 15:40 kryukov 17/122007 15:38 kryukov 17/122007 15:28 kryukov created Go Next revision . ... intas:cern-intas03:papers [17/122007 15:45] . ... intas:cern-intas03:papers [17/122007 15:53] (current) . ... CERN, 2005. intas/cern-intas03/papers.1197895500.txt.gz ТЗ Last modified: 17/122007 15:45 by kryukov . ...

Еще в разделе: (Показать все результаты (>2679) - theory.sinp.msu.ru/ )

• intas:cern-intas03:sidebar [THEP]

... Publications . ... Cosmic rays of extremely high energy . ... M.I. Panasyuk. ... B.A. Khrenov. ... M.I. Panasyuk and B.A. Khrenov. Envoys of space: far or near? Ultrahigh energy cosmic rays. ... Cosmic rays of the highest energy ? ... Space Program KOSMOTEPETL (Projects KLYPVE and TUS ) for the Study of Extremely High Energy Cosmic Rays. ... KLYPVE/TUS space experiment for study of the ultrahigh energy cosmic rays.љ ... Space Detector TUS for Extreme Energy Cosmic Rays Study. ...

Еще в разделе: (Показать все результаты (>59) - lomonosov.sinp.msu.ru/ )

• Университетский спутник "Ломоносов" | Сайт университетского спутника ...
• Automatic gaze stabilization corrector | Университетский спутник "Ломоносов"
• IMISS-1 | Университетский спутник "Ломоносов"

... Templates . ... The number n of unchanged sections which should be shown around changed sections. ... See section Templates below . ... The templates themselves are broken into 7 parts: template for start of page %REPEAT% template for unchanged section which is not printed according to context %REPEAT% template for unchanged section which is printed %REPEAT% template for changed section %REPEAT% template for added section %REPEAT% template for deleted section %REPEAT% template for end of page . ...

Еще в разделе: (Показать все результаты (>1556) - wiki.cs.msu.ru/ )

• (backlinks in all Webs) ContributedAddOns < System < Foswiki
• (backlinks in System Web) HistoryPlugin < System < Foswiki
• (backlinks in all Webs) SitePreferences < Main < Foswiki

... Anisotropy effects investigations by resistivity method. ... I.N.Modin. ... Pervago E.V., Bobachev A.A., Modin I.N., Shevnin V.A. Report, presented at Annual SAGEEP conference, April 1995, Orlando, Florida, USA. 1 p. RESISTIVITY PROSPECTING IN URBAN REGIONS . ... Bobachev A.A., Modin I.N., Pervago E.V.Proceedings of 5th EEGS-ES Meeting in Budapest, Hungary, September 1999. ... Bobachev A.A. Modin I.N., Pervago E.V., Shevnin V.A.Proceedings of 5th EEGS-ES Meeting in Budapest, Hungary, September 1999....

Еще в разделе: (Показать все результаты (>71) - geophys.geol.msu.ru/ )

• Near-surface electrical prospecting laboratory at Moscow University

... Physics Department . ... Investigations of polarization mechanisms, conductivity and relaxation processes in 2D polymer systems (Langmuir-Blodgett films), 3D polymer networks, semicrystalline polymers, crystals. ... Water in polymers. ... P.13-20, http://dx.doi.org/10.1002/app.32993 . ... O in the formation of the anomalous dielectric response of crystals and polymers near 40њC // Moscow University Physics Bulletin Volume 66, Number 3 (2011), 260-266, http://dx.doi.org/10.3103/S0027134911030076 . ...

Еще в разделе: (Показать все результаты (>319) - polly.phys.msu.ru/ )

• Selected publications of Starodubtsev, Sergey Gennadievich
• Selected publications of Ivanov, Viktor Alexandrovich
• Selected publications of Chertovich, Alexander Viktorovich

... Laboratory of laser spectroscopy of solutions of supramolecular compounds and nanostructures is very young. We have grown up in the laboratory of laser spectroscopy of water media. ... Use of such powerful modern tools of solution of inverse problems and problems of optimization provides successful solution of a wide range of applied problems of diagnostics and analysis of water media. ... 2016 Laboratory of laser spectroscopy of solutions of supramolecular compounds and nanostructures . ...

Еще в разделе: (Показать все результаты (>45) - rswater.phys.msu.ru/ )

This is a comparison of the deb, rpm, tgz, slp, and pkg package formats, as used in the Debian, Red Hat, Slackware, and Stampede linux distributions respectively (pkg is the SVr4 package format, used in Solaris). ... signed packages . yes[ 1 ] . ... Recognising that it's important sometimes to be able to peer inside packages without using their package managers, this section compares how the various packages can be processed with tools available on any linux system [ 3 ]. recognizable by file . ...

Еще в разделе: (Показать все результаты (>187) - uneex.lorien.cs.msu.su/ )

• Open Publication License
• Requirements on both unmodified and modified versions