... A parallel algorithm for solving 2D Poisson's equation in the context of nonstationary problems" . Snytnikov N.V. A new parallel method to solve the Dirichlet problem for Poisson's equation in the context of nonstationary problems of mathematical physics is proposed. ... Keywords: Poisson's equation, Dirichlet problem, domain decomposition, gravitational potential, stellar dynamics, parallel programming, scalability of algorithms. PDF (Full text in Russian, References in English) (281KB) . ...

Еще в разделе: (Показать все результаты (>141) - num-meth.srcc.msu.ru/ )

... fc3:dokuwiki:example ]] . THEP . ... Note: The Dokuwiki to be upgraded is in /var/www/wiki on the machine called mybox, I am logged in as root, and Dokuwiki version 2005-07-01 has been extracted to ~/dokuwiki/wiki/ . ... Create a temp directory mybox:/var/www# mkdir newwiki . ... Copy the changes.log file to the new location mybox:/var/www/newwiki# cp .. / wiki / changes.log data / . Copy standard data to the new location mybox:/var/www/newwiki# cp -R .. / wiki / data /* data / pages / . ...

Еще в разделе: (Показать все результаты (>14394) - theory.sinp.msu.ru/ )

• fc3:dokuwiki:example - Old revisions [THEP]
• fc3:dokuwiki:example - Recent Changes [THEP]
• fc3:dokuwiki:example - Backlinks [THEP]

Hide Zen home . ... Index . ... Also, it supports full index scan. ... Prefix search: words=# select count(*) from words where w1 like 'a%'; count ------- 15491 (1 row) Time: 7.502 ms words=# select count(*) from words where w2 like 'a%'; count ------- 15491 (1 row) Time: 31.152 ms . Wildcard search: words=# select count(*) from words where w1 like '%asd%'; count ------- 26 (1 row) Time: 147.308 ms words=# select count(*) from words where w2 like '%asd%'; count ------- 26 (1 row) Time: 0.339 ms . ...

Еще в разделе: (Показать все результаты (>1393) - www.sai.msu.su/ )

• Zen: discovery mp test
• The Name of the Plug-In: Example Images
• Zen: Gevel

... Астронет | ... планета Астронет | ... Астрофизика . ... Международная конференция "Putting A Stars into Context: Evolution, Environment, and Related Stars" . ... Международный научный оргкомитет, Государственный астрономический институт им. П.К. Штернберга, Институт астрономии РАН и Астрономическое общество проводят конференцию "Putting A Stars into Context: Evolution, Environment, and Related Stars" 3-7 июня 2013 г. в Москве в МГУ им. М.В. Ломоносова. ... Публикации с ключевыми словами: конференции...

Еще в разделе: (Показать все результаты (>5095) - www.astronet.ru/ )

• Астронет > Форумы > Обсуждение публикаций Астронета > Re: Международная
• Астронет > Форумы > Обсуждение публикаций Астронета > Международная конференция

Database: . ... Affymetrix official site . ... Clone/Gene ID converter . ... Probe set search: . Affymetrix probe set identifier example: "238900_at" . ... Search . Text search: . Gene official symbol (*-wildcard) example: "c1orf*" . Word or phrase in gene official name example: "receptor" . ... Gene search: . ENSEMBL gene identifier example: "ENSG00000026508" . NCBI Entrez Gene identifier example: 7503 . HUGO gene identifier example: 1681 . ...

Еще в разделе: (Показать все результаты (>20) - mouse.belozersky.msu.ru/ )

• Geometrical core
• Example of alignment
• Alignment example

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Войти в систему . ...

Еще в разделе: (Показать все результаты (>392) - istina.msu.ru/ )

• Spanish in Context - журнал | ИСТИНА - Интеллектуальная Система Тематического

Myotis . Uropatagium venation pattern in bats as diagnostic character (by the example of genus Myotis ) . ... By the example of genus Myotis it was shown that venation pattern on uropatagium of bats in some cases can be used as diagnostic character. Venation features on uropatagium allow easy to separate Daubentonв?Ts bat, eastern water bat, big-footed bat, and pond bat from Brandtв?Ts bat, Siberian bat, whiskered bat, and Ikonnikovв?Ts bat. ... Bats]. ... Bats of the Russian Far East]. ...

Еще в разделе: (Показать все результаты (>770) - zmmu.msu.ru/ )

• Russian Journal of Theriology

. D.Sokoloff, D.Tomin, A.Rubashny Dynamo in context of Riemannian geometry: A mathematical tool and cosmological applications, Dynamical systems, Differential equations and applications, Dresden, Germany, 2010, 74 . Ключевые слова:

Еще в разделе: (Показать все результаты (>54) - srcc.msu.ru/ )

... For those who is interested in thermodynamic modeling . Yuri Shvarov . This page is aimed mainly at the users of the software package HCh for thermodynamic (equilibrium) modeling of (geo)chemical systems and processes. However, some files presented here may also be of some interest to those who do not use HCh. ... HCh for DOS . ... User's guide for the Unitherm program intended for maintaining thermodynamic databases and calculation of thermodynamic properties of substances . ...

Еще в разделе: (Показать все результаты (>36) - www.geol.msu.ru/ )

• Software for resistivity and induced polarization

... Новости . ... Анекдоты . ... Форум . ... Мехмат , история , декан . Отделения: математики , механики , вечернее . ... MMOnline Информационный портал о мехмате МГУ . ... MMOnline и мехмат МГУ ждут вас. ... 21 июня Магистратура мехмата МГУ проведет День открытых дверей . ... Проект 'Математический форум мехмата МГУ' вышел в финальную часть конкурса 'Золотой сайт 2010' . ... На мехмате начинает работу научный семинар Современные проблемы математики и механики . ... Математический форум мехмата МГУ . ...

Еще в разделе: (Показать все результаты (>10462) - www.mmonline.ru/ )

• MMOnline | Форумы | Книжная барахолка | Продам: Учебники по английскому
• MMOnline | Форумы | Книжная барахолка | Продам: Office SharePoint Server и
• MMOnline | Форумы | Книжная барахолка | Куплю: Мейерс Effective C++ на русском

Described below are two methods for preparing input files with basis sets and ECPs which are not currently built in. ... Put basis sets and ECPs in directories (called here def2_svp_BAS and def2_ecp_ECP but you can call them whatever you want) and copy them to the Firefly directory. ... Both methods can also be used for preparing gamess (us) files - the check runs may not terminate properly due to certain keywords, but a useable file called 'input' is normally generated. ...

Еще в разделе: (Показать все результаты (>62) - classic.chem.msu.su/ )

• Firefly for Mac OS X: main page

... Run program . User's guide . Launching program . Input data format . ... Selecting the number of correlated pairs . ... In order to run thr program one needs Java 5.0 environment. ... At the end of computations one will be asked to review the selected number of correlated pairs. ... Note: One may redefine the number of correlated pairs by selecting the 'Edit' -> 'redefine correlated pairs number' menu item. Correlated pairs of positions are presented as a colored matrix, the heatmap. ...

Еще в разделе: (Показать все результаты (>136) - bioinf.fbb.msu.ru/ )

• SDPsite - Gallery of examples
• SDPlight
• Alignment example

CMS RESULTS ON THE PHYSICS OF TOP QUARKS James Keaveney Vrije Universiteit Brussel Today's talk 2 Ё Introduction and context Measurements of Top cross-sections ¤ Ё For Single Top measurements, see talk from Natalia Tsirova. Measurements of Top mass. ... Precise measurements provide electroweak constraints on new physics. ... Inclusive cross sections: top pairs (8TeV) (CMS-PAS-TOP-12-007, CMS-PAS-TOP-006) 4 e/+ jets: Template fit to distribution of lepton + b-jet invariant mass. ...

Еще в разделе: (Показать все результаты (>100) - qfthep.sinp.msu.ru/ )

You are here: Foswiki > System Web > ReferenceManual > DeveloperDocumentationCategory > IfStatements (22 Feb 2011, ProjectContributor ) E dit A ttach . The %IF% macro gives you the ability to test for macro values, URL parameters, access permissions, topic existence and more. ... Test if macro is defined . ... Test if URL param is passed . ... IF{"CONDITION" then="THEN" else="ELSE"}% . ... X' can be a login name or a wikiname. defined . ... IF{"defined PARAM" then="THEN" else="ELSE"}% . ... Test . ...

Еще в разделе: (Показать все результаты (>2181) - wiki.cs.msu.ru/ )

• (backlinks in System Web) LoginName < System < Foswiki
• (backlinks in all Webs) LoginName < System < Foswiki
• HistoryPlugin < System < Foswiki

... Software . Laboratory of Mathematical Methods of Image Processing . ... Available options: -sigma - (mandatory) set blur parameter for the input image , range: 1.0 to 20.0 - power - set warping power , range: 0.0 to 5.0, default value is 1.0 -1d - apply one-dimensional algorithm (faster but lower quality) basicedges - detect basic edges - edges good for artifact analysis -scale - set scale parameter, range: 1.0 to 20.0, default value is 4.0 gaussblur - blur input ... warp.png . ...

Еще в разделе: (Показать все результаты (>55) - imaging.cmc.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>8) - storage.bioinf.fbb.msu.ru/ )

Alignment COG1325 . ... It is supported by 29 positions - that's written on the scheme. ... Such are positions number 5 ( leucine opposite isoleucine , valine and methyonine ), 30 ( glutamic acid opposite arginine , glycine and serine ), 51 ( threonine opposite alanine , phenylalanine and serine ), 55 ( phenylalanine opposite leucine , histidine and tyrosine ), 111 ( phenylalanine opposite isoleucine , leucine and valine ), 123 ( valine opposite isoleucine , ...

Еще в разделе: (Показать все результаты (>62) - monkey.belozersky.msu.ru/ )

• SDP home page
• SCOP famyli:
• ETS numeration assumed

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>65) - geophys.geol.msu.ru/ )

• TES tecnology. MSU.
• TES. Field example.
• Software for resistivity and induced polarization

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>13) - tukachev.flogiston.ru/ )

• Category: Новости

Theory of filtering and time series processing L. Zotov Laboratory work ?6 Purpose: Studying singular spectral analysis SSA. We use Matlab software (look into the Lab N1). 1) Download the program and additional module for the lab from http://lnfm1.sai.msu.ru/grav/english/lecture/filtering/ Study the SSA package on examples. 2) Download and install program from http://www.gistatgroup.com/cat/cat33.exe Study it. Visit http://www.gistatgroup.com/gus/examples.html

Еще в разделе: (Показать все результаты (>114) - lnfm1.sai.msu.ru/ )

• http://lnfm1.sai.msu.ru/grav/english/lecture/filtering/Lab5.doc
• Index (english)
• IDL programs