. GMAIL .

Еще в разделе: (Показать все результаты (>3) - astrometric.sai.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2013.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf

BOOKMARK [0][-]{chapter*.2}{Foreword}{}% 1 \ BOOKMARK [0][-]{chapter*.3}{Glossary}{}% 2 \ BOOKMARK [0][-]{chapter.1}{Introduction to the Introduction}{}% 3 \ BOOKMARK [1][-]{section.1.1}{ Plants , Botany, and Kingdoms}{chapter.1}% 4 \ BOOKMARK [2][-]{subsection.1.1.1}{Taxonomy}{section.1.1}% 5 \ BOOKMARK [2][-]{subsection.1.1.2}{Methods of Taxonomy and Diagnostics}{section.1.1}% 6 \ BOOKMARK [1][-]{section.1.2}{Styles of ...

Еще в разделе: (Показать все результаты (>24) - herba.msu.ru/ )

• http://herba.msu.ru/shipunov/school/biol_240/en/visual_statistics.out

Given word length and max number of mismatches . Use MEME algorithm for define conserved blocks . Apply the Dynamic programming algorithm to create chain of the blocks . Refine the chain using combined profile for chain of blocks. ... Reduce word length and number of mismatches and repeat the procedure for spacer between the blocks. ... Create helix profile and apply MEME-like iterative procedure to find sets of helices that consistent lokated reative to conserved blocks . ...

Еще в разделе: (Показать все результаты (>15) - bioinf.fbb.msu.ru/ )

• SDPlight
• Alignment example
• SDPpred

... The safest is to let URLPARAM encode the unsafe characters (default) but this prevents the user from entering Foswiki macros in the comment input fields. ... Generic prompt box used by other templates % TMPL : DEF {promptbox}% div class= commentPlugin commentPluginPromptBox table border= 0 cellpadding= 0 ... valign= middle td textarea %DISABLED% rows= %rows|3% cols= %cols|70% name= comment class= foswikiInputField onfocus= if(this.value=='%MESSAGE%')this.value='' onblur= if(this.value ...

Еще в разделе: (Показать все результаты (>1929) - wiki.cmc.msu.ru/ )

1) Faculty of Soil Science, Moscow State University, Moscow 119899, Russia; . ... We assessed critical loads of acid deposition and their exceedance for soils in the Kola Peninsula using a simple balance method and mapped them within 1.0° Ї 0.5° longitude/latitude grid cells. ... Terrestrial ecosystems in the north-western Kola Peninsula are particularly susceptible to acid deposition damage due to relatively high soil sensitivity and heavy sulphur deposition. back . ...

Еще в разделе: (Показать все результаты (>27) - eco.soil.msu.ru/ )

• EFFECTS OF ACID DEPOSITION ON ACIDITY IN PODZOLS
• CRITICAL LOADS OF ACID DEPOSITION IN EUROPEAN RUSSIA
• SIMULATION OF ACID SNOW AND RAIN IMPACT ON FORESTS

Alignment in free decaying MHD turbulence" . ... Using a shell model of turbulence, we have investigated a long-time evolution of magnetic and velocity fields in the MHD turbulence with various types of initial states. ... For most realizations, a coherent state with high alignment between the magnetic and velocity fields has been developed. In the case of establishment of the coherent state, the dissipation rate of energy is found to be substantially reduced. ...

Еще в разделе: (Показать все результаты (>9) - num-meth.srcc.msu.ru/ )

The QGroupBox widget provides a group box frame with a title. ... QGroupBox ?(?QWidget?*?parent=0, const?char?*?name=0?)? . QGroupBox ?(?const?char?*?title, QWidget?*?parent=0, const?char?*?name=0?)? . const?char*? title ?()?const . ... int? alignment ?()?const . ... Constructs a group box widget with no title. ... Constructs a group box with a title. ... Returns the alignment of the group box title. ... Sets the alignment of the group box title. ... Sets the group box title text to title. ...

Еще в разделе: (Показать все результаты (>43) - rtm-cs.sinp.msu.ru/ )

• Qt Reference Documentation
• Qt Toolkit - QBoxLayout Class
• Qt Documentation

... О UNИX . ... HelpOnImages . Неизменяемая страница . ... Working With Images . ... If you just want to get an image on a page, simply upload the image file (using the 'Attachments' link). ... For example, if you put large image {{attachment:duckie.png}} into the middle of a paragraph, like this , then that's exactly what you'll get. ... This example uses a chair image that's aligned left. Notice that paragraph text flows around it, so you can (for example) stagger images on the page. ...

Еще в разделе: (Показать все результаты (>43) - uneex.lorien.cs.msu.su/ )

• HelpOnTables - UNИX
• Online Unix References and Tutorials
• WikiCourse/15 Tables - UNИX

... О UNИX . ... HelpOnImages . Неизменяемая страница . ... Working With Images . ... If you just want to get an image on a page, simply upload the image file (using the 'Attachments' link). ... For example, if you put large image {{attachment:duckie.png}} into the middle of a paragraph, like this , then that's exactly what you'll get. ... This example uses a chair image that's aligned left. Notice that paragraph text flows around it, so you can (for example) stagger images on the page. ...

Еще в разделе: (Показать все результаты (>23) - uneex.mithril.cs.msu.su/ )

• HelpOnTables - UNИX
• WikiCourse/15 Tables - UNИX

... G. K. Zhavnerko, V. N. Staroverov, V. E. Agabekov, M. O. Gallyamov, I. V. Yaminsky . ... Atomic force microscopy, ellipsometry, and piezoquartz microweighing techniques were used to study the characteristic of N-octadecyl-3,4:9,10-perylene-bis(dicarboxydiimide) monomolecular layers... <more> . ... The influence of the chemical structure of film-forming material, the pressure of deposition, and the nature of substrate upon the film morphology has been studied by atomic force microscopy... <more> . ...

Еще в разделе: (Показать все результаты (>7) - www.spm.genebee.msu.ru/ )

Annotation of the graduate work of 6th-year student I.V. Yakimchuk Study of the Whispering Gallery Effect at a Spherical Surface in Hard X-Ray Region Whispering gallery (WhG) effect consists in that an x-ray/soft x-ray bea m falling tangentially onto a concave surface slides along it due to successive total external reflections. ... Ray-tracing computer code is used to analyze experimental data. Results of measurements and computer simulations are demonstrated to be in an excellent agreement. ...

Еще в разделе: (Показать все результаты (>43) - ofvp.phys.msu.ru/ )

• Grant detail

Key-words: rhythm, stress, syllable, rhythmic structure, syntagm, utterance, prosody, speech production, speech perception . ... In speech communication, RS are both units of speech production and speech perception. ... The research of speech rhythm in diachrony and synchrony consists of the analysis and the description of speech rhythmic units concerning Old Church Slavonic, Old Russian, Old High German in diachrony and Modern Russian, German, Czech and Bulgarian in synchrony. ...

Еще в разделе: (Показать все результаты (>47) - www.philol.msu.ru/ )

• LangueDOC :: Tools :: Text conversions

... 32Bits Online: because there's more than one way to compute . New about new versions of computer related stuff . AAA Matilda Web Search . ... Search . ... The Music Database . ... Musicians looking for other musicians (Free Service) . ... The Mac Game Database uses PHP and MySQL . ... Bioinformatics databases at the Montreal Children's Hospital using MySQL . ... DSL providers search with reviews Made with MySQL and Modperl, all pages are generated dynamically out of the MySQL database . ...

Еще в разделе: (Показать все результаты (>25) - itpm.msu.su/ )

• Alignment, font styles, and horizontal rules in HTML documents

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Nurtdinov R.N. , Vasiliev M.O. , Ershova A.S. , Lossev I.S. , Karyagina A.S. в журнале Nucleic Acids Research , издательство Oxford University Press (United Kingdom) , том 38, ? ... Nurtdinov R.N. , Mironov A.A. , Gelfand M.S. в журнале Biofizika , издательство Izdatel'stva Nauka (Russian Federation) , том 47, ? ...

Еще в разделе: (Показать все результаты (>133) - istina.msu.ru/ )

• Feuerstein B. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Marquette A. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Paripas B. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

Annotation: in the article possibilities of psychodynamic analysis of anecdote are exposed in accordance with changes in the structure of subjective psychological time. Keywords: anecdote, psychodynamic of anecdote, subjective time, psychological time, structure of psychological time, color of time. ... 2007 . ... 2009. ...

Еще в разделе: (Показать все результаты (>79) - chronos.msu.ru/ )

Fred Ewalt image: . I revisted my series of 5 raw images on SN1999gp. The attached UGC 1993 field image is the summation of five co-aligned and added one minute raw exposures (vice averaged, which was used for the processed image I submitted yesterday). ... The probable Foreground Star, SN1999gp and the Nucleus of UGC 1993 are all apparent in this field image. The second "Inset - A image", I blew up and normalized to the same pixel count as the field image. ... Back to 1999gp . ...

Еще в разделе: (Показать все результаты (>2) - www.rochesterastronomy.org/ )

Teaching courses . for student of the Department of Astrophysics and Stellar Astronomy . ... Geophysics and physics of the planets (Kurt, Panteleev) . ... Close Binary Stars . ... Solar Physics . ... This is introductory course for students of the third year of education which are familiar with elementary astronomy and general physics. ... The one-year course includes theory of radiation transfer, theory of internal stellar structure with account of binary systems with compact comapnions. ...

Еще в разделе: (Показать все результаты (>156) - crydee.sai.msu.ru/ )

• Long description of example illustrating table row height calculations and
• Alignment, font styles, and horizontal rules in HTML documents
• Index

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Рейтинг: 0 . нужен стандарт ANSI C. 03.05.2005 12:33 . ... Re: нужен стандарт ANSI C. [ re: LIfelike ] . ... A: Copies are available in the United States from . ...

Еще в разделе: (Показать все результаты (>37) - www.snto-msu.net/ )

• Как импортнуть закладки в файрфоксе? - Public forum of MSU united student

... Siberian Lang . Minority languages of Siberia as our cultural heritage . ... The project ?Development of the web-site ?Minority languages of Siberia as our cultural heritage? (on the material of the languages of the basin Middle Yenisei and the Middle and the Upper Taz)? was realized at the Laboratory for Computational Lexicography, Research Computing Centre, Lomonosov Moscow State University, with financial support from Russian Foundation for the Humanities, grant 12-04-12049.  ...