... Attributes . ... This requires that attributes be tagged either as ``C,'' ``C++'' or ``Fortran,'' and that the language tag be checked in order to use the right calling convention for the callback function. ... The attribute manipulation functions described in Section 5.7 of the MPI-1 standard define attributes arguments to be of type void* in C, and of type INTEGER, in Fortran. ... Fortran attribute functions put and get integer valued attributes. ... A. C to Fortran . ... Fortran code . ... Центры...

Еще в разделе: (Показать все результаты (>195) - www.parallel.ru/ )

• Window Attributes | PARALLEL.RU - Информационно-аналитический центр по
• Clarification of Error Behavior of Attribute Callback Functions | PARALLEL.RU -
• New Attribute Caching Functions | PARALLEL.RU - Информационно-аналитический

... public class Attribute . ... They have a name, type and an array of values. ... Attribute (java.lang.String name, double value) . ... If the value represents an array type, returns the Class object representing the component type of the array; otherwise returns null. int . ... Constructor Detail public Attribute (java.lang.String name, java.lang.Number value) . ... public Attribute (java.lang.String name, double value) . ... public Attribute (java.lang.String name, java.lang.Object theValue) . ...

Еще в разделе: (Показать все результаты (>51) - angel.cs.msu.su/ )

• : Interface AttributeSet
• : Class ProtoVariable
• : Class Schema

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

Network Working Group Request for Comments: 1464 R. Rosenbaum Digital Equipment Corporation May 1993 Using the Domain Name System To Store Arbitrary String Attributes Status of this Memo This memo defines an Experimental Protocol for the Internet community. ... Abstract While the Domain Name System (DNS) [2,3] is generally used to store predefined types of information (e.g., addresses of hosts), it is possible to use it to store information that has not been previously classified. ...

Еще в разделе: (Показать все результаты (>8748) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1464.txt
• Index of /pub/gentoo-portage/virtual/perl-Attribute-Handlers/

BOOKMARK [0][-]{chapter*.2}{Foreword}{}% 1 \ BOOKMARK [0][-]{chapter*.3}{Glossary}{}% 2 \ BOOKMARK [0][-]{chapter.1}{Introduction to the Introduction}{}% 3 \ BOOKMARK [1][-]{section.1.1}{ Plants , Botany, and Kingdoms}{chapter.1}% 4 \ BOOKMARK [2][-]{subsection.1.1.1}{Taxonomy}{section.1.1}% 5 \ BOOKMARK [2][-]{subsection.1.1.2}{Methods of Taxonomy and Diagnostics}{section.1.1}% 6 \ BOOKMARK [1][-]{section.1.2}{Styles of ...

Еще в разделе: (Показать все результаты (>32) - herba.msu.ru/ )

• http://herba.msu.ru/shipunov/school/biol_240/en/visual_statistics.out

Given word length and max number of mismatches . Use MEME algorithm for define conserved blocks . Apply the Dynamic programming algorithm to create chain of the blocks . Refine the chain using combined profile for chain of blocks. ... Reduce word length and number of mismatches and repeat the procedure for spacer between the blocks. ... Create helix profile and apply MEME-like iterative procedure to find sets of helices that consistent lokated reative to conserved blocks . ...

Еще в разделе: (Показать все результаты (>15) - bioinf.fbb.msu.ru/ )

• Alignment example
• SDPpred
• Site Cluster

... About lab . ... Online Journal "Computer graphics and multimedia" (in russian) . ... Simultaneous facial attribute classification with convolutional neural networks . ... Project: Face recognition and classification . ...

Еще в разделе: (Показать все результаты (>45) - graphics.cs.msu.ru/ )

• How diamond performance attributes: brilliance, scintillation and fire depend
• Large-lexicon attribute-consistent text recognition in natural images |

Application of evolutionary model in the evaluation of the quality of pair wise alignment of amino acid sequences Valery Polyanovsky, V. G. Tumanyan Engelhardt Institute of Molecular Biology, Russian Academy of Sciences, Moscow, 119991 Russia ... : polyanovskyvo@mailfrom.ru, tuman@eimb.ru The purpose of the work is to develop a universal method for estimating the pairwise alignment quality depending on the evolutionary distance (degree of homology) between the ... REFERENCES 1. ...

Еще в разделе: (Показать все результаты (>74) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/197.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/215.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/161.pdf

Alignment in free decaying MHD turbulence" . ... Using a shell model of turbulence, we have investigated a long-time evolution of magnetic and velocity fields in the MHD turbulence with various types of initial states. ... For most realizations, a coherent state with high alignment between the magnetic and velocity fields has been developed. In the case of establishment of the coherent state, the dissipation rate of energy is found to be substantially reduced. ...

Еще в разделе: (Показать все результаты (>30) - num-meth.srcc.msu.ru/ )

The QGroupBox widget provides a group box frame with a title. ... QGroupBox  ( QWidget * parent=0, const char * name=0 )  . QGroupBox  ( const char * title, QWidget * parent=0, const char * name=0 )  . const char*  title  () const . ... int  alignment  () const . ... Constructs a group box widget with no title. ... Constructs a group box with a title. ... Returns the alignment of the group box title. ... Sets the alignment of the group box title. ... Sets the group box title text to title. ...

Еще в разделе: (Показать все результаты (>145) - rtm-cs.sinp.msu.ru/ )

• Linux Threads Home Page: How do Linux Threads compare with other OSs'?
• Qt Toolkit - QBoxLayout Class
• Apache module mod_setenvif

... у jquery есть еще куча механизмов . http://api.jquery.com/category/selectors/ . ... RTFM http://www.w3.org/TR/CSS/selector.html#adjacent-selectors . ...

Еще в разделе: (Показать все результаты (>1490) - www.fds-net.ru/ )

• Virus? - Public forum of MSU united student networks
• Sse.Zone. (sequel. life 2) - Public forum of MSU united student networks
• Как импортнуть закладки в файрфоксе? - Public forum of MSU united student

. Search: . Login . Preferences . About Trac . Timeline . Roadmap . Browse Source . View Tickets . Search . Reverse Diff . (No files) . Note: See TracChangeset for help on using the changeset viewer. Unified Diff . Zip Archive . Powered by Trac 0.12.5 . By Edgewall Software . Visit the Trac open source project at . http://trac.edgewall.org/

Еще в разделе: (Показать все результаты (>260) - kodomo.cmm.msu.su/ )

... Planets In The Sun . ... Credit Copyright: SOHO - LASCO Consortium, ESA , NASA Explanation: Today , all five naked-eye planets (Mercury, Venus, Mars, Jupiter, Saturn) plus the Moon and the Sun will at least approximately line-up. ... And what about the Moon ? ... Publications with keywords: Jupiter - Mars - planet - Saturn - Sun - planetary alignment - Moon . Publications with words: Jupiter - Mars - planet - Saturn - Sun - planetary alignment - Moon . ... Neon Saturn . ... Moons and Jupiter . ...

Еще в разделе: (Показать все результаты (>3052) - www.astronet.ru/ )

• Journal "Peremennye Zvezdy"
• Астронет > Планеты на западе
• Planets Above The Clouds

NAME ab - Apache HTTP server benchmarking tool SYNOPSIS ab [ - k ] [ - i ] [ - n requests ] [ - t timelimit ] [ - c con- currency ] [ - p POST file ] [ - A Authenticate username : password ] [ - P Proxy Authenticate username : password ] [ - H Custom header ] [ - C Cookie name = value ] [ - T content - type ] [ - v verbosity ] [ - w output HTML ] [ - x table attributes ] [ - X proxy [:port] ] [ - y tr ... Default is no KeepAlive. - i Use an HTTP 'HEAD' instead of the GET method. ...

Еще в разделе: (Показать все результаты (>30) - neptun.sai.msu.ru/ )

• Apache module mod_setenvif
• Definitions of terms used to describe Apache modules
• Definitions of terms used to describe Apache directives

Verwaltung f?r Berufsberatung und Betreuung talentierter Jugend . ... Im Rahmen der LXXVI Moskauer Physik ? Sch?lerolympiade f?r das 7. bis 11. Schuljahr findet am 22.Februar 2015 an der Fakult?tf?r Physik (MSU) die 2. theoretische Runde statt. ... 2016 - Verwaltung f?r Berufsberatung und Betreuung talentierter Jugend ...

Еще в разделе: (Показать все результаты (>95) - talant.msu.ru/ )

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Войти в систему . ... Feuerstein B. , Grum-Grzhimailo A.N. , Bartschat K. , Mehlhorn W. в журнале Journal of Physics B: Atomic, Molecular and Optical Physics , издательство Institute of Physics Publishing (United Kingdom) , том 32, ? ...

Еще в разделе: (Показать все результаты (>142) - istina.msu.ru/ )

• Marquette A. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Matterstock B. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Huster R. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

... Tarkowska E. Poverty and education // Pol. sociol. rev . W-wa, 2002. ... Эмпирические исследования в Польше в 1997-2001 гг. по проблемам отношения власти и образования. ... Ключевые слова: Государство и высшая школа. ЗАРУБЕЖНЫЕ УНИВЕРСИТЕТЫ. ЕВРОПА. ... Перспективы развития частного высшего образования в различных странах: материалы конференции, состоявшейся в г. Тбилиси, апрель 2002 г. Ключевые слова: Частное образование. ... СТАТЬИ . ... Ключевые слова: Частное образование. ...

Еще в разделе: (Показать все результаты (>15) - srcc.msu.ru/ )

... Работы участников . ... Добавлена новая тема. Продолжается прием конкурсных работ для участия в отборочном туре. ... На сайте Фестиваля опубликованы электронные адреса вузов-соорганизаторов Фестиваля. ... На сайте Фестиваля началась публикация работ участников. ...

39. FileAttribute < System < Foswiki

40. Seminar in Polymer Physics