An Aurora Before the Storm . ... Credit Copyright: Jan Curtis ( U. Alaska ), ACRC . Explanation: Early April brought some of the most intense auroral storms this decade. ... Auroral activity occurs high in the Earth's atmosphere and is a direct result of storms on our Sun . As huge sheets of charged particles stream out from the Sun, a small fraction of these particles are funneled in by Earth's magnetic field and strike atoms high in the atmosphere, causing the sky to glow. ...

Еще в разделе: (Показать все результаты (>3424) - www.astronet.ru/ )

• Астронет > An Aurora Before the Storm
• An Aurora Before the Storm

... About lab . ... Conference "GraphiCon" . Online Journal "Computer graphics and multimedia" (in russian) . ... Age Estimation Using Additional Unlabeled Face Images . ... Conference Paper . ... Age estimation , Face classification , Local Binary Pattern , machine learning . ... Automatic age estimation from face images is an important and actual problem due to its practical significance. ... Most face recognition databases meet this condition and enable age estimation rate improvement. ...

Еще в разделе: (Показать все результаты (>71) - graphics.cs.msu.ru/ )

• Age Estimation Using Additional Unlabeled Face Images | Лаборатория
• Simultaneous facial attribute classification with convolutional neural networks
• How diamond performance attributes: brilliance, scintillation and fire depend

... Next: Fast probe landing and Up: Client Previous: Photodiode (AFM mode) Contents Index . FemtoScan `` client-program has a number of additional commands to work with during scanning. These commands allow to execute some special operations on microscope control and interface configuration. ... Fast probe landing and retraction . ... Images saving mode . ... Next: Fast probe landing and Up: Client Previous: Photodiode (AFM mode) Contents Index Filonov 2005-02-04 ...

Еще в разделе: (Показать все результаты (>40) - www.spm.genebee.msu.ru/ )

• Additional data acquiring channels
• Format of Legend
• COM-port calibration

... MPI_Attr_delete . Deletes attribute value associated with a key #include "mpi.h" int MPI_Attr_delete ( comm, keyval ) MPI_Comm comm; int keyval; . ... All MPI routines (except MPI_Wtime and MPI_Wtick ) return an error value; C routines as the value of the function and Fortran routines in the last argument. ... The error handler may be changed with MPI_Errhandler_set ; the predefined error handler MPI_ERRORS_RETURN may be used to cause error values to be returned. ... MPI_ERR_COMM . ... Центры . ...

Еще в разделе: (Показать все результаты (>437) - www.parallel.ru/ )

• MPI_Keyval_free | PARALLEL.RU - Информационно-аналитический центр по
• Introduction | PARALLEL.RU - Информационно-аналитический центр по параллельным
• Window Creation | PARALLEL.RU - Информационно-аналитический центр по

... Astro-ph E-print archive . THE NASA ASTROPHYSICS DATA SYSTEM . ... Tables of contents . ... Multimission Archive at STScI . Local archive of IAUC IRCULARS . ... Astrophysical Constants (PDF) . ... Starcast search in astronomy archives . ... Cambridge University Press Handbook of Space Astronomy and Astrophysics . ... Astronomy Astrophysics . Astronomy Astrophysics Supplement Series . Astrophysical Journal . Astrophysical Journal Supplement Series . ... Galka Homepage ...

Еще в разделе: (Показать все результаты (>156) - xray.sai.msu.ru/ )

• Shakura Nikolai Ivanovich
• Sergei Popov's Bookmarks
• Bookmarks for Sergei Popov

install ]] . ... Installation of a user directory . ... Below, we use the following notations: XXXX - CompHEP version number; comphep-XXXX - directory where CompHEP files will live; comphep-XXXX.tgz - distributive tar-file with sources; comphep-XXXX-linux.tgz - distributive tar-file with binaries; . ... The directory with name comphep-XXXX will be created with all files of CompHEP distributive. ... In order to create a user working directory execute: make setup WDIR=path_to_user_work_directory . ...

Еще в разделе: (Показать все результаты (>87) - comphep.sinp.msu.ru/ )

... NASA ADS . ... Astronet . ... Sergei Popov's Bookmarks . ... Russian Academy of Sciences . SETI-site of the Stenberg Astronomical Institute . ... Shvartsman V.F. Gurevich I.M. Panov A.D. Movie Database . ... Subtitles 1 . ... Writers Guild of America . ... Ancient Rome . ...

Еще в разделе: (Показать все результаты (>73) - lnfm1.sai.msu.ru/ )

• Bookmarks for Andrew I. Zakharov
• Bookmark

. GMAIL .

Еще в разделе: (Показать все результаты (>3) - astrometric.sai.msu.ru/ )

... Finance - Currency Conversion . FXConverter - OANDA's 164 Currency Converter . ... PNAS Online -- Search Multiple Journals . ... Scirus - For Scientific Information Only . Molecular Biology Software . Education and Genetics: Human Genome Project Information . Journal of Computational Biology Table of Contents . LINK Alert Service - Subscribe . Springer LINK - Forum for Science . ... Genome Biol Vol. ... COMPUTATIONAL BIOLOGY . ... Journal Impact Factor 2000 . ...

Еще в разделе: (Показать все результаты (>48) - higeom.math.msu.su/ )

... Search for Single Top Quark Production at DZero using Neural Networks" . ... Search for Single Top Quark Production at D0 Using Neural Networks" . ... Search for Electroweak Production of Single Top Quarks" . ... Use of Neural Networks in a Search for Single Top Quark Production at D0", . ... Search for Single Top Quark Production at the Tevatron" . ... Use of Neural Networks in a Search for Single Top Quark Production with the DZero Detector at the Fermilab Tevatron Collider", . ...

Еще в разделе: (Показать все результаты (>3) - top.sinp.msu.ru/ )

... We have recently provided detailed insight into structural aspects and chemical behaviour of several alkali-metal acylpyrazolonato systems. Here we extend our study on the interaction of these donors toward zinc(II) and cadmium(II) acceptors in the presence of several mono- and bidentate ancillary ligands. Hydrated or solvated bis(acylpyrazolonate)metal derivatives can be readily obtained, which are stabilized in the solid state by extensive intermolecular H-bonding. ...

Еще в разделе: (Показать все результаты (>118) - chem.msu.ru/ )

... public class Attribute . ... They have a name, type and an array of values. ... Attribute (java.lang.String name, double value) . ... If the value represents an array type, returns the Class object representing the component type of the array; otherwise returns null. int . ... Constructor Detail public Attribute (java.lang.String name, java.lang.Number value) . ... public Attribute (java.lang.String name, double value) . ... public Attribute (java.lang.String name, java.lang.Object theValue) . ...

Еще в разделе: (Показать все результаты (>52) - angel.cs.msu.su/ )

• : Interface AttributeSet
• : Class ProtoVariable
• : Class Schema

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

... Many protein families contain homologous proteins that have a common biological function but different specificity. Given a multiple sequence alignment of a family divided into specificity groups, SDPpred predicts a set of alignment positions ( SDP, Specificity-Determining Positions ) that determine differences in the functional specificity. ... 2004) Automated selection of positions determining functional specificity of proteins by comparative analysis of orthologous groups in protein families. ...

Еще в разделе: (Показать все результаты (>15) - bioinf.fbb.msu.ru/ )

• RNA Alignment
• Alignment example
• Site Cluster

BOOKMARK [0][-]{chapter*.2}{Foreword}{}% 1 \ BOOKMARK [0][-]{chapter*.3}{Glossary}{}% 2 \ BOOKMARK [0][-]{chapter.1}{Introduction to the Introduction}{}% 3 \ BOOKMARK [1][-]{section.1.1}{ Plants , Botany, and Kingdoms}{chapter.1}% 4 \ BOOKMARK [2][-]{subsection.1.1.1}{Taxonomy}{section.1.1}% 5 \ BOOKMARK [2][-]{subsection.1.1.2}{Methods of Taxonomy and Diagnostics}{section.1.1}% 6 \ BOOKMARK [1][-]{section.1.2}{Styles of ...

Еще в разделе: (Показать все результаты (>61) - herba.msu.ru/ )

• http://herba.msu.ru/shipunov/school/biol_240/en/visual_statistics.out
• http://herba.msu.ru/shipunov/school/biol_154/2010_2011/lec_06.pdf

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . ... Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: by an additional situation . ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . Вы не можете публиковать новые темы в этом форуме . ...

Еще в разделе: (Показать все результаты (>2687) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: through an additional challenge
• Экологический Форум - Фундаментальная Экология: by means of an additional
• Экологический Форум - Фундаментальная Экология: via an additional problem

Traditional methods, connected with use of one microphone as an input of speech signal into a computer, do not give us a high reliability of recognition. If signal-to-noise relation (SNR) is 0-6 dB, the probability of an error even in identification of speech activity using only one microphone in typical cases is not less than 10% (as experiments and literature data show). ... The far-positioned (third) microphone can be used to estimate the average level of an external noise. ...

Еще в разделе: (Показать все результаты (>30) - www.intsys.msu.ru/ )

• Options

Lomonosov Moscow State University . ... Divisions and Departments . Academic Programs . ... International Cooperation . ... Academic Departments Programs . ... International Studies . ... Additional Training Opportunities . ... Bulletin of Moscow University . ... Faculty of Foreign Languages and Area Studies Lomonosov Moscow State University: . 119192, Russia, Moscow, Lomonosov Str., ... 2000 - 2016 Faculty of Foreign Languages and Area Studies Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>83) - ffl.msu.ru/ )

• Site map
• Faculty of Foreign Languages and Area Studies
• About Us

Starting Apache on Windows . Starting Apache on Unix . ... If the Port specified in the configuration file is the default of 80 (or any other port below 1024), then it is necessary to have root privileges in order to start Apache, so that it can bind to this privileged port. ... As an alternative to invoking the httpd binary directly, a shell script called apachectl is provided which can be used to control the daemon process with simple commands such as apachectl start and apachectl stop . ...

Еще в разделе: (Показать все результаты (>53) - neptun.sai.msu.ru/ )

• Apache module mod_setenvif
• Apache Tutorial: Introduction to Server Side Includes
• Apache module mod_isapi

Application of evolutionary model in the evaluation of the quality of pair wise alignment of amino acid sequences Valery Polyanovsky, V. G. Tumanyan Engelhardt Institute of Molecular Biology, Russian Academy of Sciences, Moscow, 119991 Russia ... : polyanovskyvo@mailfrom.ru, tuman@eimb.ru The purpose of the work is to develop a universal method for estimating the pairwise alignment quality depending on the evolutionary distance (degree of homology) between the ... REFERENCES 1. ...

Еще в разделе: (Показать все результаты (>111) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/104.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/161.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/164.pdf