... Creating logfiles . Up: The MPE library of useful extensions Next: Parallel X Graphics Previous: The MPE library of useful extensions . You can create customized logfiles for viewing with upshot by calls to the various mpe logging routines. For details, see the mpe man pages. ... All mpe logging routines . ... Up: Creating logfiles Next: Other
 mpe
 routines Previous: Creating logfiles . ... Up: Creating logfiles Next: Profiling libraries Previous: Parallel X Graphics . ... Центры . ...

Еще в разделе: (Показать все результаты (>244) - www.parallel.ru/ )

• Automatic Report Generation | PARALLEL.RU - Информационно-аналитический центр

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>236) - monkey.belozersky.msu.ru/ )

• ETS_all_contacts alignment
• Inquiry information || Formats of alignments
• SVETKA, a program for multiple sequence alignments analysus

PHP Manual . ... Variables . ... When a form is submitted to a PHP script, any variables from that form will be automatically made available to the script by PHP. ... Simple form variable . form action="foo.php" method="post"> Name: <input type="text" name="username"><br> <input type="submit"> </form> . ... The experienced may note that the actual variable names sent by the browser contains a period rather than an underscore, but PHP converts the period to an underscore automatically. ...

Еще в разделе: (Показать все результаты (>156) - oit.cmc.msu.ru/ )

• Apache module mod_status
• Constructors
• Predefined variables

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

... Поиск по МГУ | Лента новостей | ... О проекте . ... Please, enter the code that you see below in the input field. This is for blocking bots that try to post this form automatically. If the code is hard to read, then just try to guess it right. If you enter the wrong code, a new image is created and you get another chance to enter it right. ... 2003 2011 MsuNews.Ru Новости МГУ . 2003 2011 Разработка и дизайн MMForce.Net . ... Экспорт новостей (RSS) ...

Еще в разделе: (Показать все результаты (>5) - www.msunews.ru/ )

• MsuNews.Ru | Новости МГУ
• MsuNews.Ru | Блог проекта
• MsuNews.Ru | Энциклопедия

. Click here to jump to currently working version . http://www.pereplet.ru/misl.shtml . If your browser supports it, you will automatically be transferred.

Еще в разделе: (Показать все результаты (>37) - xray.sai.msu.ru/ )

The QBoxLayout class lines up child widgets horizontally or vertically. ... QBoxLayout  ( QWidget * parent, Direction, int border=0, int autoBorder = -1, const char * name=0 )  . ... QBoxLayout takes the space it gets (from its parent layout or from the mainWindget()), divides it up into a row of boxes and makes each managed widget fill one box. ... The stretch factor applies only in the direction of the QBoxLayout, and is relative to the other boxes and widgets in this QBoxLayout. ...

Еще в разделе: (Показать все результаты (>279) - rtm-cs.sinp.msu.ru/ )

• Apache module mod_status
• Qt Toolkit - QGroupBox Class
• Qt Toolkit - QGIFFormatType Class

... Set PEER_DNS="no" to stop this. PEER_DNS="yes" # OpenVPN can run in many modes. Most people will want the init script # to automatically detect the mode and try and apply a good default # configuration and setup scripts. ... DETECT_CLIENT="yes" # If DETECT_CLIENT is no and you have your own scripts to re-enter the openvpn # init script (ie, it first becomes "inactive" and the script then starts the # script again to make it "started") then you can state this below. ...

Еще в разделе: (Показать все результаты (>5897) - mirror.msu.net/ )

• http://mirror.msu.net/pub/gentoo-portage/www-apps/moodle/files/postinstall-en.txt
• http://mirror.msu.net/pub/gentoo-portage/net-proxy/http-replicator/files/http-replicator-4.0_alpha2-r2.conf
• http://mirror.msu.net/pub/gentoo-portage/sys-apps/ifplugd/ifplugd-0.28-r9.ebuild

... Traditional interactive representation of the genome in a text format (FASTA, FASTQ) is not always convenient for the analysis of molecular omics data. In particular, information on a reference genome is available via the Internet poorly structured and do not provide a comprehensive automatic analysis of a set of genes, transcripts, exons, introns and thus excluded aggregations of data across the genome. ... Note that it always remains in the DB hyperlink on the primary interactive data portals. ...

Еще в разделе: (Показать все результаты (>67) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/237.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/215.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/183.pdf

Given word length and max number of mismatches . Use MEME algorithm for define conserved blocks . Apply the Dynamic programming algorithm to create chain of the blocks . Refine the chain using combined profile for chain of blocks. ... Reduce word length and number of mismatches and repeat the procedure for spacer between the blocks. ... Create helix profile and apply MEME-like iterative procedure to find sets of helices that consistent lokated reative to conserved blocks . ...

Еще в разделе: (Показать все результаты (>15) - bioinf.fbb.msu.ru/ )

• Alignment example
• SDPpred
• Site Cluster

All Firefly versions can take optional command line arguments. ... firefly [optional command line options in any order] [optional list of working directories] . ... The list of most widely used command line options is given below: . ... Disables validity check of the command line arguments (e.g., check for valid names of files and directories, etc...) passed to Firefly. ... However, if this option is not given, one must provide the list of working directories when running Firefly in parallel mode. ...

Еще в разделе: (Показать все результаты (>66) - classic.chem.msu.su/ )

• PC GAMESS/Firefly DOCUMENTATION - SMP, multicore and HTT features
• Large files support in the PC GAMESS/Firefly

... An initialized swap space is taken into use with swapon . ... It will tell the total amount of swap space used. $ free total used free shared buffers Mem: 15152 14896 256 12404 2528 -/+ buffers: 12368 2784 Swap: 32452 6684 25768 $ The first line of output ( Mem: ) shows the physical memory. The total column does not show the physical memory used by the kernel, which is usually about a megabyte. ... Sometimes a lot of swap space can be in use even though there is a lot of free physical memory. ...

Еще в разделе: (Показать все результаты (>147) - itpm.msu.su/ )

• Access control
• Other Programs - Apache HTTP Server
• Miscellaneous Files

This module provides information on server activity and performance. ... Compatibility: Available in Apache 1.1 and later. ... ExtendedStatus To enable status reports only for browsers from the foo.com domain add this code to your httpd.conf configuration file <Location /server-status> SetHandler server-status Order Deny,Allow Deny from all Allow from .foo.com </Location> . ... A machine-readable version of the status file is available by accessing the page http://your.server.name/server-status?auto . ...

Еще в разделе: (Показать все результаты (>34) - neptun.sai.msu.ru/ )

• Apache module mod_auth_db

... Next: Plane tab Up: Client Previous: Connection to a Server Contents Index . Figure 2.4: Scan parameters. STM mode of operation. ... AFM mode of operation. ... All scan parameters can be configures in Parameters window (pic. ... Client part of `` FemtoScan '' software allows to control microscope operating in three different scanning modes - tunneling mode(STM), atomic-force mode (AFM) and resonance atomic-force (RAFM). ... It(Z) tab (STM mode), F(Z) tab (AFM mode), D(Z) tab (RAFM mode). ...

Еще в разделе: (Показать все результаты (>20) - www.spm.genebee.msu.ru/ )

• Client list
• Oscilloscope
• Fast probe retraction

Funding of applicants from non-EU countries & international organisations Version 1.0 14 February 2014 Cooperation with participants from third countries and international organisations Horizon 2020-Open to the world! ... They are not always automatically entitled to funding. ... 3 Cooperation with participants from third countries and international organisations Additionally, any applicant based in a country which is Associated to Horizon 2020 is automatically eligible for funding. ...

Еще в разделе: (Показать все результаты (>12) - ideas.msu.ru/ )

. This is the entry page for LangueDOC site. In a few moments you'll be automatically redirected to the home page (in Russian) . Please click here to choose English instead. Это входная страница сайта LangueDOC. Через несколько секунд броузер должен автоматически перейти на главную страницу (на русском языке) . Если вы хотите перейте на английскую версию , пожалуйста, щелкните эту ссылку .

Еще в разделе: (Показать все результаты (>37) - www.philol.msu.ru/ )

... Content Model: Table Cells (TH or TD) . The TR element acts as a container for a row of table cells defined with the TH or TD elements. ... You also have the ability to disable word wrap for the row, and thereafter use the <BR> element to determine line breaks and hence cell widths. ... The recommended approach is to subclass rows using the CLASS attribute For example: <TABLE BORDER COLSPEC= .. ... ALIGN . ... This is used when you want to ensure that all cells in the row share the same baseline. ...

Еще в разделе: (Показать все результаты (>40) - comet.sai.msu.ru/ )

• Entering carriage returns
• Index of manual pages: V
• Saving mail in folders

MGU Botanic Garden . SCHEDULE OF EXCURSIONS FOR INDIVIDUAL VISITORS . If you want to express your opinion about our excursions or suggest any proposals and make remarks, write us at otzyv_botsad@mail.ru . ... The excursion bureau of the MSU Botanical Gardens invites in May-October schoolchildren, students and anyone wishing to admire the open air collections and listen to the captivating stories about plants. ... Plant taxonomy (for schoolchildren and university students) . ...

Еще в разделе: (Показать все результаты (>2) - botsad.msu.ru/ )

. Please press http://www.hist.msu.ru/ER/English/index.htm if you are not redirected automatically within 5 seconds

Еще в разделе: (Показать все результаты (>10) - hist.msu.ru/ )

This page has moved. If your browser doesn't automatically redirect to its new location, click here .

Еще в разделе: (Показать все результаты (>10) - www.fadr.msu.ru/ )