... The lists of flora of Kem-Ludy archipelago (Russian White Sea, near Arctic Circle) produced in years 1962 and 2001-2004 were investigated by different methods of data analysis. The full species list contains 284 species. 27 islands were studied, four new islands were appeared due to the tectonic events. ... Most important factors are island square and openness (accessibility for winds). ... Marine birds are most important biological factor for island flora maintenance. ...

Еще в разделе: (Показать все результаты (>186) - herba.msu.ru/ )

• Systema Naturae
• ALGAE AND THEIR CHANGES OVER TIME
• Изменения морфологии кувшинки при обработке живого материала

... Next: Turning sound on Up: Additional commands Previous: Actions with obtained files Contents Index . Obtained files are stored with filenames that were given according to the information you entered during connection ( 2.2.1 section). If you want to change these names, select SPM/ File names... menu command. Window that contains 6 pairs of fields (pic. 2.16 ) will appear. ... When new file appears number in the second pair field increased by 1. ...

Еще в разделе: (Показать все результаты (>113) - www.spm.genebee.msu.ru/ )

• Change in inner data representation
• Changing Image Resolution
• Changing window size

ChangeLog for / # # Generated by Trac 0.12.5 # 04/11/16 15:49:58 Mon , 20 Dec 2010 13:12:55 GMT Daniil Alexeyevsky me.dendik@тАж [34:b7a85caedc7f] * body.py ( added ) * game.py ( added ) * tk_ui.py ( added ) * user.py ( added ) * vector.py ( added ) Re-imported files after merge Mon , 20 Dec 2010 13:11:34 GMT Daniil Alexeyevsky me.dendik@тАж [33:a92686be9c95] * body.py (deleted) * ...

Еще в разделе: (Показать все результаты (>753) - kodomo.cmm.msu.su/ )

• http://kodomo.cmm.msu.su/trac/tanchiki/log/?format=changelog&rev=33%3Aa92686be9c95&limit=100&mode=stop_on_copy
• http://kodomo.cmm.msu.su/trac/tanchiki/log/?format=changelog&rev=a92686be9c95c31b91d91aa1be6952eb5cfb02bb&limit=100&mode=stop_on_copy
• http://kodomo.cmm.msu.su/trac/tanchiki/log/?format=changelog&rev=b7a85caedc7f13c63a83881fb25b2c4e371a63e7&limit=100&mode=stop_on_copy

Лаборатория концентрирования, общая информация . ... общих вопросов аналитической химии (история, терминология, география, кадры, популяризация и др.; академик Ю.А. Золотов); . сорбционного концентрирования элементов, органических соединений и поиска новых сорбентов (группы д.х.н. Г.И. Цизина, д.х.н. С.Г. Дмитриенко, д.х.н. Е.И. Моросановой); . разработки экспрессных тест-методов химического анализа, главным образом вне лаборатории (группы д.х.н. Е.И. Моросановой, д.х.н С.Г. Дмитриенко); . ...

Еще в разделе: (Показать все результаты (>31) - analyt.chem.msu.ru/ )

... File Size . Up: Consistency and Semantics Next: Examples Previous: Logical vs. ... The size of a file may be increased by writing to the file after the current end of file. ... Consider a set of bytes that has been written to a file since the most recent call to a size changing routine, or since MPI_FILE_OPEN if no such routine has been called. ... Given two operations made by separate processes to a file containing 100 bytes: an MPI_FILE_READ of 10 bytes and an MPI_FILE_SET_SIZE to 0 bytes. ...

Еще в разделе: (Показать все результаты (>572) - www.parallel.ru/ )

• MPI_Attr_put | PARALLEL.RU - Информационно-аналитический центр по параллельным
• Error Handlers | PARALLEL.RU - Информационно-аналитический центр по
• Symmetric Multiprocessors (SMPs) | PARALLEL.RU - Информационно-аналитический

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . ... Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: to Six the changed this of as Matteo in W . ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . Вы не можете публиковать новые темы в этом форуме . ...

Еще в разделе: (Показать все результаты (>3143) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: changed, luxury domestic
• Экологический Форум - Фундаментальная Экология: rare. get changed of growth
• Экологический Форум - Фундаментальная Экология: You attitude to change can

... METHOD . ... public interface AttributeSet . AttributeSet is an inquiry interface for a collection of Attributes. ... Tests if the Attribute identified by name is in this set. ... Retrieve the attribute associated with the specified name. ... Returns AttributeIterator for the elements. ... a new Array containing the elements of this set. public Attribute get (java.lang.String name) . ... If a different Attribute with the same name, was in the set, it is returned, otherwise null is returned. ...

Еще в разделе: (Показать все результаты (>88) - angel.cs.msu.su/ )

• : Class Schema
• Appendix D NetCDF 2 C Transition Guide

. [ Войти ] . Главная -> Фильмы -> How William Shatner Changed .. Пользователи . Демо . Деньги . Фильмы . Форум . How William Shatner Changed the World . Канада 2005 . отметить . Документальный . Фантастика .

Еще в разделе: (Показать все результаты (>139) - kinfo.ru/ )

• The Day the Universe Changed - Фильмы - Kinfo.ru
• Steve Irwin: He Changed Our .. - Фильмы - Kinfo.ru
• The Man Who Changed His Mind - Фильмы - Kinfo.ru

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... changed ]как поиграться в Ларри, который на \\Ultra лежит . ... Re: как поставить Ларри, который на \\Ultra лежит [ re: Kirillay ] . ...

Еще в разделе: (Показать все результаты (>4836) - www.snto-msu.net/ )

• Детализация рейтинга: Changes - Public forum of MSU united student networks
• Настройка cvsup во FreeBSD 6.2 для новичка. - Public forum of MSU united
• комиксзона + - Public forum of MSU united student networks

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... продаю чайник " Philips "!!(price has changed) . ... Re: продаю чайник " Philips "!! [ re: shield ] . ... IT IS WORKING IN EXCELLENT STATUS?? ...

Еще в разделе: (Показать все результаты (>6266) - www.fds-net.ru/ )

• Детализация рейтинга: Changes - Public forum of MSU united student networks
• Active Directory смена пароля - Public forum of MSU united student networks
• Настройка cvsup во FreeBSD 6.2 для новичка. - Public forum of MSU united

fitshdr_edit - FITS-file headers interactive editor fitshdr_edit [options] FITSfile_name . fitshdr_edit utility allows to modify FITS headers' lines interactively (FITS MultiExtentionsFiles included). fitshdr_edit is just simple shell script around fitshdr utility. ... It means, that You can't remove line from header! ... 560:CRDELT2 = 21.0 / this is example 640: 720:HISTORY header No.0: 1st history line 123456789012345678901234567 880:COMMENT Sat Sep 25 21:17:34 CEST 2004 / by fitshdr_edit . ...

Еще в разделе: (Показать все результаты (>177) - lnfm1.sai.msu.ru/ )

• FITShdr: INSTALL
• IDL programs
• Manpage of FITSHDR

... This file is maintained via ncm-krb5clt(1), local changes may be lost. If you need to add your realm, look at the template file ; in /usr/lib/ncm/config/krb5clt/etc_krb5.conf.tpl ; or get in touch with project-elfms@cern.ch [libdefaults] default_realm = CERN.CH ticket_lifetime = 25h renew_lifetime = 120h forwardable = true proxiable = true [realms] CERN.CH = { default_domain = cern.ch kpasswd_server = afskrb5m.cern.ch admin_server = afskrb5m.cern.ch kdc = afsdb2.cern.ch ...

Еще в разделе: (Показать все результаты (>12) - lhe.sinp.msu.ru/ )

• http://lve.sinp.msu.ru/~rud/Atlas/soft/configuration.log1

... Войти в систему . ... 2015 Holocene environmental changes in southern Kamchatka, Far Eastern Russia, inferred from a pollen and testate amoebae peat succession record // Global and Planetary Change . Klimaschewski?L A. , Barnekow?K D. , Bennett A.A. , Andreev E., Andr?n A.A. , Bobrov , Hammarlund D. в журнале Global and Planetary Change , издательство Elsevier BV (Netherlands) , с. 1-8 DOI . ... в журнале Global and Planetary Change , издательство Elsevier BV (Netherlands) , том 102, с. 1-9 DOI . ...

Еще в разделе: (Показать все результаты (>2209) - istina.msu.ru/ )

• Technological Forecasting and Social Change - журнал | ИСТИНА -
• Global Change Biology - журнал | ИСТИНА - Интеллектуальная Система
• Nature climate change - журнал | ИСТИНА - Интеллектуальная Система

... Instructions are in README.TXT file inside the tarball. ... tar -xvf nhunt_x86.tar Query and database files should contain sequences in FASTA format ( wikipedia description ). ... Default name of the output file is 'nhunt.out'. ... Any parameter consists of key and value and is called as '-key value', where 'key' is one character and 'value' is any number of characters. -i Query file . ... No default value. -d Database file . ... No default value. -o Output file . ... Default value: 'nhunt.out' . ...

Еще в разделе: (Показать все результаты (>24) - mouse.genebee.msu.ru/ )

... Mysterious Changing feature on Titan . ... 15.10.2014 . ... Credit Copyright: Cassini Radar Mapper , ASU , JPL , ESA , NASA Explanation: What is that changing object in a cold hydrocarbon sea of Titan? Radar images from the robotic Cassini spacecraft orbiting Saturn have been recording the surface of the cloud-engulfed moon Titan for years. ... Subsequent observations in 2014 found the object remained -- but had changed! ... Publications with keywords: Titan . Publications with words: Titan . ...

Еще в разделе: (Показать все результаты (>8901) - www.astronet.ru/ )

• Астронет > Mysterious Changing feature on Titan
• Three Month Composite of Comet Holmes
• Journal "Peremennye Zvezdy"

... Soviet Industrial Production, 1928-1950: Real Growth, Hidden Inflation, and the 'Unchanged' Prices of 1926/27, . ... Soviet central planners developed the 'unchanged prices of 1926/27' to facilitate their regulation of production enterprises and ministries. ... Producers pressed continually for higher 'unchanged' prices. ... The most important consequence was an upward bias in measuring the growth of real output ("hidden inflation"). ...

Еще в разделе: (Показать все результаты (>136) - hist.msu.ru/ )

... Seasonal changes in microsomal fraction enriched with Na,K-ATPase from kidneys of the ground squirrel Spermophilus undulatus. ... The Na,K-ATPase activity in microsomal fraction isolated from kidneys of winter hibernating ground squirrels was found to be 1.8-2.0-fold lower than that in active animals in summer. ... We suggest that the decrease in Na,K-ATPase activity in kidneys of ground squirrels during hibernation is mainly connected with the aggregation of proteins in plasma membrane. ...

Еще в разделе: (Показать все результаты (>72) - biochem.bio.msu.ru/ )

• Thermally induced structural changes of intrinsically disordered small heat
• Redox-dependent change of nucleotide affinity to the active site of the
• Binding of ouabain and marinobufagenin leads to different structural changes in

... Elton L. The UK research assessment exercise: unintended consequences // Higher education quart . ... Vol. ... Ключевые слова: Государство и высшая школа. ЗАРУБЕЖНЫЕ УНИВЕРСИТЕТЫ. ... СТАТЬИ . ... Jarvis P. The changing university: Meeting a need and needing to change // Higher education quart. ... 2001. ... США. ... Ключевые слова: США. ... Taylor J. The impact of performance indications on the work of university academics: evidence from Australian universities // Higher education quart . ...

Еще в разделе: (Показать все результаты (>120) - srcc.msu.ru/ )

• Kazakevich, Olga [Казакевич О.А.]. Language functioning and language changes in

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>191) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• OUTPUT
• BLAST 2.0 Release Notes

... Change password . Please enter the checkword and your new password . Login . Checkword . New password Confirm password . Recover password . ... Please log in. ... Password . ... Forgot password? Password request . Send me checkword . ... E-mail . ... If you cannot remember your password, enter your login or e-mail you have used for registration. A message containing the check word you can use to change the password will be sent to your e-mail. ... One-time password . ...

Еще в разделе: (Показать все результаты (>4) - www.ffl.msu.ru/ )

• Get Password - Факультет иностранных языков
• Authorization - Факультет иностранных языков