This file has three main parts: *Introduction (a guide to using Terror) *General info (standard for wads) *Play information (standard) Please take the time to at least read the introduction, which contains some important information. ... Terror is a new level for Doom2 players to try their luck at. ... The DeHacked file] DO NOT DISTRIBUTE THE FILE TERR.EXE IN ANY FORM! ... Using Terror] The easiest way to use Terror is to unzip the file TERROR.ZIP and copy all the files into your Doom2 directory. ...

Еще в разделе: (Показать все результаты (>3079) - crydee.sai.msu.ru/ )

• http://crydee.sai.msu.ru/ftproot/pub/comp/os/linux/slackware-2.3/SLAKWARE/A1/DISKA1
• http://crydee.sai.msu.ru/ftproot/pub/rec/games/idgames/levels/doom/a-c/basilica.txt
• http://crydee.sai.msu.ru/ftproot/pub/rec/games/idgames/levels/doom/d-f/dmprtl.txt

... This file is written in text format and consists from several sections. The order of this sections doesn't important. ... These sections should be described in the file: init , sample , var , var.scale (not nessesarly) , var.display (not nessesarly). ... init_read - Number of bytes needed to be read after string init have been sent. ... If additional data channel is enabled ( 2.1.2 ) during DSP board initialization it sends strings [init]init to chosen COM-port and reads [init]init_read bytes. ...

Еще в разделе: (Показать все результаты (>57) - www.spm.genebee.msu.ru/ )

• Working with files, containing Curves
• Image formation and processing methods
• Instrument panel

Maximum RPM: Taking the Red Hat Package Manager to the Limit . ... Every package built for RPM has to have a specific set of information that uniquely identifies it. We call this information a package label. ... Every package label begins with the name of the software. ... Next in the package label is an identifier that describes the version of the software being packaged. ... When a package file is created, part of the filename consists of the package label. ... The information includes: . ...

Еще в разделе: (Показать все результаты (>412) - uneex.lorien.cs.msu.su/ )

• important. unimportant.
• Configuration Sections - Apache HTTP Server
• HelpOnInstalling/WikiInstanceCreation - UNИX

... The Department of Operations Research . April 9, 2016 . Welcome Traditional topics of the conference Important dates Abstracts Registration . Final program Accommodation Program committee Organizing committee . ... V Moscow International Conference . on Operations Research, . ... Moscow, April 10-14, 2007 Important dates . ... Abstract deadline: December 20, 2006 . New deadline: January 10, 2007 . Notification of submission: February 1, 2007 . Create Date : 23.05.05 . ...

Еще в разделе: (Показать все результаты (>11) - io.cs.msu.ru/ )

• Abstracts - ORM 2007

... This family contains a protein with resolved 3D structure: Q8UK99_AGRT5/3-102 , pdb ID: 1vqy . SDPsite predicts following important positions (numbering corresponds to 1vqy ): . ... 90S, 55W . ... 76W, 8Y, 46G, 55W, 39G, 63R . ... 8Y, 39G, 55W, 63R, 76W, 90S . ... Mapping predictions onto structure of 1vqy : . Associated grouping: . Group 1 . Q7ZWJ6_BRARE/154-253 . Q6DJ76_XENTR/154-253 . ... NPS3B_HUMAN/146-245 . ...

Еще в разделе: (Показать все результаты (>132) - bioinf.fbb.msu.ru/ )

• SDPsite - PF01205
• SDPsite - PF01206
• SDPsite - PF01171

... The purpose of this work was to perform the computer analysis of amino acid sequences of inulinase from various producers, which creates preconditions to drawing up of forecasts concerning molecular features of enzyme, mechanism of catalysis, functional groups of the active center. ... Data on primary structures of inulinase we received in National Center for Biotechnology Information (http://www.ncbi.nlm.hin.gov/Entrez), alignment of amino acids sequences we spent at use of software package BioEdit...

Еще в разделе: (Показать все результаты (>114) - www.mce.biophys.msu.ru/ )

• Heat transfer in non-uniform by structure monodisperse system, containing

... Главная -> Фильмы -> Important c'est d'aimer, L' . ... Фильмы . ... Important c'est d'aimer, L' . ... Jacques Dutronc . Claude Dauphin . ... Michel Robin . Guy Mairesse . ... Jacques Boudet . ... Jacques Jourdan . Claude Legros . ... Michel Such . Jacques Van Dooren . ... G?rard Zimmermann . ... Michel Berreur . Guy Delorme . ... Michel Duchaussoy . ... G?rard Moisan . ...

Еще в разделе: (Показать все результаты (>52) - kinfo.ru/ )

• Very Important Person - Фильмы - Kinfo.ru
• Important News - Фильмы - Kinfo.ru
• ?v?nement le plus important .. - Фильмы - Kinfo.ru

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>102) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help

. General Information . News . Organizing Committee . Program . Registration . Registered participants . Symposium expenses . Accommodation and meal . Important deadlines . Presentation information . Abstract submission . Cultural Program . Travel information . Contact information . 14 European Symposium on . Gas Phase Electron Diffraction . 24-28 June 2011 . M. V. Lomonosov Moscow State University . 1 February 2011 . deadline for Registration . 20 April 2011 . deadline for Abstract submission .

Еще в разделе: (Показать все результаты (>14) - ged.chem.msu.ru/ )

... Las clases inician el 01 de Septiembre . ExАmenes Ordinarios Finales: del 01 al 25 de Diciembre . ... Los exАmenes (parciales) no son calificados cuantitativamente. ... El alojamiento en los dormitorios para estudiantes varМa desde $165.00 Dls. mensuales (dependiendo de las condiciones de equipamiento de la vivienda). ... Es importante aclarar que no existe ningЗn tipo de beca para estudiantes internacionales. ... 203 000 . ... Para mayor informaciСn, por favor no dude en contactarnos. ...

Еще в разделе: (Показать все результаты (>14) - foroff.phys.msu.ru/ )

• Глубокоуважаемые коллеги

news ]] . ... Highlight news: CompHEP is in the top rating list on The OpenScience Project . ... 16/03/2009 New official version of CompHEP (4.5.1) is available. ... 14/11/2006 Two new versions of CompHEP-PYTHIA interface (cpyth-1.2.7 and cpyth-2.0.4) are available. ... 13/09/2006 A new version of CompHEP-PYTHIA interface and a new interface CompHEP-HERWIG has been released. ... 01/07/2006 Talk on new physics with CompHEP by M.Dubinin at Tools for SUSY and the New Physics (LAPP, 26-28 June 2006). ...

Еще в разделе: (Показать все результаты (>15) - comphep.sinp.msu.ru/ )

• extra:main [CompHEP]

... Structure, properties, and functions of the human small heat-shock protein HSP22 (HspB8, H11, E2IG1): a critical review. ... The recently described human HSP22 belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain. ... Therefore, an investigation of the structure and properties of HSP22 is desirable for understanding its multiple functions. ... Depending on the cell type and its expression, HSP22 might have either pro- or anti-apoptotic effects. ...

Еще в разделе: (Показать все результаты (>46) - biochem.bio.msu.ru/ )

• The role of intrinsically disordered regions in the structure and functioning
• Structure and properties of chimeric small heat shock proteins containing
• Cardioprotective effect of histidine-containing dipeptides in pharmacological

... О UNИX . ... Every time you copy those files (and modify the configuration of your server accordingly), you create what is called a wiki instance . ... Some of the steps you need to take depend on which web server and which operating system you use. ... it is also possible to put the web server and the normal user in the same group , and then only open the instance directory to the members of that group. ... Now, you need to tune the configuration of your web server and of your wiki instance. ...

Еще в разделе: (Показать все результаты (>154) - uneex.mithril.cs.msu.su/ )

... METHOD . ... public interface AttributeSet . AttributeSet is an inquiry interface for a collection of Attributes. ... Tests if the Attribute identified by name is in this set. ... Retrieve the attribute associated with the specified name. ... Returns AttributeIterator for the elements. ... a new Array containing the elements of this set. public Attribute get (java.lang.String name) . ... If a different Attribute with the same name, was in the set, it is returned, otherwise null is returned. ...

Еще в разделе: (Показать все результаты (>70) - angel.cs.msu.su/ )

• : Interface DimensionSet
• : Class Schema
• : Class AbstractNetcdf

... I mean the following Theorem If any local eld (x) is irreducible and [ (x), (y )] = B (x - y ), (1) then operator B (x) is multiple of unit operator, that is (x) is an asymptotic eld. ... Our result is most interesting in the case of noncommutative theory, precisely, in the case of space-space noncommutativity, in which time commutes with spatial variables and, as a consequence, one spatial variable, say x3, commutes with others. ... For simplicity we consider the case of neutral scalar elds. ...

Еще в разделе: (Показать все результаты (>83) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/talks/rep_Yu_QFTHEP.pdf
• http://qfthep.sinp.msu.ru/proceedings2015/Quant_Bezuglov.pdf

In general, homing endonucleases are meganucleases (i.e. they recognise and cut DNA sequences longer than 12 bp) encoded in various intervening sequences. ... Here we investigate the diversity of yeast intein-encoded LAGLIDADG endonucleases, and annotate their particular residues in terms of importance for DNA recognition, binding and cleavage. PFAM family PF05204 contains sequences of most of the yeast intein-encoded LAGLIDADG endonucleases. ...

Еще в разделе: (Показать все результаты (>589) - monkey.belozersky.msu.ru/ )

• PDB entries containing domains of the family "Protein kinase domain"
• PDB entries containing domains of the family "ATP synthase alpha/beta family,
• PDB entries containing domains of the family "Pancreatic ribonuclease"

A very important stage in a story of formation of any new science is the shift from discussion of situation which are possible but do not occur in practice due to some reason to recognition of real phenomena of interest. ... We suggest to consider computer viruses as this new specific form of life which is coming in the contact with our form of life. ... Computer life has been created by human being, the role of independent evolution of computer viruses seems to be still negligible. ...

Еще в разделе: (Показать все результаты (>116) - lnfm1.sai.msu.ru/ )

• Data bases of Natural Satellites. Documentation. Structure
• Russian SETI

... PDB . ... Domain instances . ... POLYMERASE/COMPLEX . ... POLYMERASE . ... TRANSFERASE/RNA . ... TRANSFERASE . ... total (16 entries) . ... No comments on this family . Send your questions and comments to sas@belozersky.msu.ru . ...

Еще в разделе: (Показать все результаты (>70) - mouse.belozersky.msu.ru/ )

• PDB entries containing domains of the family "Ribbon-helix-helix protein, copG
• S : rm_systems
• PLANdbAffy: probe-level annotation database for Affymetrix expression

40. Compiling Apache for Microsoft Windows