An Annular Solar Eclipse at High Resolution . ... Because of the relatively large distance to the Moon during this Earth-Moon-Sun alignment, the Moon did not have a large enough angular size to block the entire Sun . Those who witnessed the solar eclipse from a narrow path through Spain and Africa , however, were lucky enough to see the coveted Ring of Fire , a dark Moon completely surrounded by the brilliant light of the distant Sun. ... NASA Web Site Statements, Warnings, and Disclaimers . ...

Еще в разделе: (Показать все результаты (>7253) - www.astronet.ru/ )

• Unusual Giant Galaxy NGC 1316
• Asteroids in the Distance
• Астронет > Asteroids in the Distance

... Attributes . ... This requires that attributes be tagged either as ``C,'' ``C++'' or ``Fortran,'' and that the language tag be checked in order to use the right calling convention for the callback function. ... The attribute manipulation functions described in Section 5.7 of the MPI-1 standard define attributes arguments to be of type void* in C, and of type INTEGER, in Fortran. ... Fortran attribute functions put and get integer valued attributes. ... A. C to Fortran . ... Fortran code . ... Центры...

Еще в разделе: (Показать все результаты (>177) - www.parallel.ru/ )

• Window Attributes | PARALLEL.RU - Информационно-аналитический центр по
• Clarification of Error Behavior of Attribute Callback Functions | PARALLEL.RU -
• New Attribute Caching Functions | PARALLEL.RU - Информационно-аналитический

... public class Attribute . ... They have a name, type and an array of values. ... Attribute (java.lang.String name, double value) . ... If the value represents an array type, returns the Class object representing the component type of the array; otherwise returns null. int . ... Constructor Detail public Attribute (java.lang.String name, java.lang.Number value) . ... public Attribute (java.lang.String name, double value) . ... public Attribute (java.lang.String name, java.lang.Object theValue) . ...

Еще в разделе: (Показать все результаты (>50) - angel.cs.msu.su/ )

• : Interface AttributeSet
• : Class ProtoVariable
• : Class Schema

Swiss PDBViewer . Swiss-PdbViewer is an application that provides a user friendly interface allowing to analyse several proteins at the same time. ... Swiss-PdbViewer can also read electron density maps, and provides various tools to build into the density. In addition, various modelling tools are integrated and command files for popular energy minimization packages can be generated. ... None . ... SAL Home | Other Scientific Fields | Chemistry, Biology Related . ...

Еще в разделе: (Показать все результаты (>1368) - www.sai.msu.su/ )

• SAL- Other Scientific Fields - Chemistry, Biology Related - PHYLO_WIN
• APOD: 2013 February 10 - Asteroids in the Distance
• APOD: 2011 March 6 - Asteroids in the Distance

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

Russian . Next: Isolines Up: Cursor modes Previous: Sections Contents Index . Distance Mode allows to measure the distance between points on the surface. The distance is measured as a projection on X-Y plane, the distance along Z direction is not accounted. The measured value is presented near the drawn line. Russian . Next: Isolines Up: Cursor modes Previous: Sections Contents Index Filonov 2005-02-04

Еще в разделе: (Показать все результаты (>38) - www.spm.genebee.msu.ru/ )

• Changing Image Resolution

... PHP 3 <= 3.0.18, PHP 4 >= 4.0.0) ldap_get_attributes -- Get attributes from a search result entry . ... return_value[0] = first attribute . ... ds is the link identifier for the directory // $sr is a valid search result from a prior call to // one of the ldap directory search calls $entry = ldap_first_entry($ds, $sr); $attrs = ldap_get_attributes($ds, $entry); echo $attrs["count"]." attributes held for this entry:<p>"; for ($i=0; $i<$attrs["count"]; $i++) echo $attrs[$i]."<br>"; . ...

Еще в разделе: (Показать все результаты (>134) - oit.cmc.msu.ru/ )

• ldap_first_attribute
• hw_Modifyobject
• ldap_next_attribute

... About lab . ... Online Journal "Computer graphics and multimedia" (in russian) . ... Simultaneous facial attribute classification with convolutional neural networks . ... Project: Face recognition and classification . ...

Еще в разделе: (Показать все результаты (>35) - graphics.cs.msu.ru/ )

• How diamond performance attributes: brilliance, scintillation and fire depend
• Large-lexicon attribute-consistent text recognition in natural images |

. [ Войти ] . Главная -> Фильмы -> Keep Your Distance . Пользователи . Демо . Деньги . Фильмы . Форум . Keep Your Distance . Держи дистанцию . 2005 . отметить . Триллер . Мистика . Stu Pollard . Rick Overton . Brooke L. Berry . Lisa Baldwin . Stacy Keach . Matt Wheeler . Jamie Harrold . Cynthia Martells . Gary Anthony Williams . Gil Bellows . Jennifer Westfeldt . Christian Kane . Elizabeth Pe?a . Steve Carlson . Jenny McShane . Dennis Burkley . Kim Raver .

Еще в разделе: (Показать все результаты (>17) - kinfo.ru/ )

• Going the Distance - Фильмы - Kinfo.ru
• Striking Distance - Фильмы - Kinfo.ru
• Long Distance - Фильмы - Kinfo.ru

... About CIE MSU . Academic Programmes . ... Student's Life . ... Vestnik CIE (in Russian) . ... Distance Learning . The Center offers an engaging online interactive course of the Russian language and culture for intermediate and advanced students Russia On Air . The course is designed to help learners gain an expanded view of contemporary Russia through Russian mass media. ... take charge of your learning the Russian language and organize it in a way that is most suitable for you. ...

Еще в разделе: (Показать все результаты (>13) - www.cie.ru/ )

• Enseignement ? distance :: Les programmes d?enseignement :: CEI
• Academic Programmes :: CIE
• Les programmes d?enseignement :: CEI

GEOMETRIC MORPHOMETRICS a numerical approach to analysis of shapes of morphological objects . ... DЭrer`s painting ( XVI ) ' D'Arcy Thompson painting ( X ) 3 SHAPE ANALYSIS = Analytical approaches = morphometrics ­ Principal task is numerical analysis of shapes diversity : Particular tasks: Comparison of shapes themselves Analysis of causes of shapes differences Classification of objects by their shapes 4 SHAPE ANALYSIS = Analytical approaches = ...

Еще в разделе: (Показать все результаты (>490) - zmmu.msu.ru/ )

Alignment in free decaying MHD turbulence" . ... Using a shell model of turbulence, we have investigated a long-time evolution of magnetic and velocity fields in the MHD turbulence with various types of initial states. ... For most realizations, a coherent state with high alignment between the magnetic and velocity fields has been developed. In the case of establishment of the coherent state, the dissipation rate of energy is found to be substantially reduced. ...

Еще в разделе: (Показать все результаты (>17) - num-meth.srcc.msu.ru/ )

... Геоморфологии и палеогеографии . Географии мирового хозяйства . ... Гидрологии суши . ... Выберите кафедру . ... Ученый совет . ... Образование . ... Научно-методический совет по экологии Министерства образования и науки РФ . ... distance . ... Кафедра геоморфологии . ... Все сообщения пользователя . ... Текст cooбщения . ... Кафедра геоморфологии Кафедра гидрологии . ... Информация о предстоящих защитах диссертаций на соискание ученой степени кандидата, доктора географических наук Подробнее . ...

Еще в разделе: (Показать все результаты (>47) - www.geogr.msu.ru/ )

• distance (участник тем)
• distance (автор тем)

The QGroupBox widget provides a group box frame with a title. ... QGroupBox  ( QWidget * parent=0, const char * name=0 )  . QGroupBox  ( const char * title, QWidget * parent=0, const char * name=0 )  . const char*  title  () const . ... int  alignment  () const . ... Constructs a group box widget with no title. ... Constructs a group box with a title. ... Returns the alignment of the group box title. ... Sets the alignment of the group box title. ... Sets the group box title text to title. ...

Еще в разделе: (Показать все результаты (>108) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - QFontMetrics Class
• Linux Threads Home Page: How do Linux Threads compare with other OSs'?
• Qt Toolkit - QBoxLayout Class

... Учитель: Anna Agametova . Учитель: Elena Dudnikova . Учитель: Uliana Proshina . Учитель: Keith Rawson-Jones . Учитель: Lyudmila Georgievna Sizykh . Учитель: Victoria Alexandrovna Skakunova . Учитель: Elena Troitskaya . Учитель: Роза Амиралиева . Учитель: Наталия Антоненко . Учитель: Светлана Сергеевна Беляева . Учитель: Сергей Каликанов . Учитель: Ирина Владимировна Куцель . Учитель: Илона Максимова . Учитель: Елена Малышева . ...

Еще в разделе: (Показать все результаты (>3) - moodle.ffl.msu.ru/ )

• moodle: English Language Courses

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Войти в систему . ...

Еще в разделе: (Показать все результаты (>200) - istina.msu.ru/ )

• Distances et Savoirs - журнал | ИСТИНА - Интеллектуальная Система Тематического
• Feuerstein B. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Marquette A. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

diff -Nru tic98 /Makefile tic98.gentoo /Makefile --- tic98 /Makefile 1999-06-22 05:00:58.000000000 - 0400 +++ tic98.gentoo /Makefile 2002-10-19 18:20:55.000000000 - 0400 @@ -1,4 +1,4 @@ -BIN=/home/singlis/linux/bin +BIN=/usr/bin IMAGES=/home/ml/singlis LIBTIC= LIBS= -lm #-L/home/singlis/linux/lib -lccmalloc -ldl @@ -180,4 +180,4 @@ boundary.o getopt.o windowing.o $(CC) -o $@ $^ $(LIBS) - \ No newline at end of file + diff -Nru tic98 /arithcode.c ...

Еще в разделе: (Показать все результаты (>7557) - mirror.msu.net/ )

• Index of /pub/gentoo-portage/dev-haskell/edit-distance/
• Index of /pub/gentoo-portage/virtual/perl-Attribute-Handlers/

... Natalya V. Raguzova and Sergei B. Popov . ... We present a compilative catalogue of Be/X-ray binaries and candidates in the Galaxy and in the Large and Small Magellanic Clouds. This catalogue contains 160 sources and provides information on names and spectral types of optical components, distances, on spin characteristics of neutron stars, and on orbital and X-ray properties of binary systems. ... Be/X-Ray Binaries and candidates in the Galaxy . Galactic sources: comments to the Table 1 . ...

Еще в разделе: (Показать все результаты (>157) - xray.sai.msu.ru/ )

• The Stopping Radius
• AXAF-Chandra

Russian Language Training via INTERNET. Internet-based educational hypertexts: some results of formal approach. ... Comparative study of Internet-based educational curricula in Russian Phonetics was based upon formal criteria and objective evidence concerning: (1) coincidence of navigational patterns embedded in a web-presentation of course material to main cognitive patterns of students, (2) rate of hypertext optimisation, (3) adjustability to different academic syllabuses and educational modes. ...

Еще в разделе: (Показать все результаты (>107) - www.philol.msu.ru/ )

Rastorguev А.S. "Astronomical Distances" (Lecture course for postgraduates, 2009-2016) . Part 1. ... Trigonometric parallaxes of stars. Moving clusters distances. ... Photometric distances: general approach. Normal stars as "standard candles". ... Main Sequence fitting or distance scale of star clusters. ... Moving photospheres technique. Cepheid distance scale and P-L relations. RR Lyrae distance scale. ... Globular clusters luminosity function. ...

Еще в разделе: (Показать все результаты (>116) - lnfm1.sai.msu.ru/ )

• Alexey Sergeevich Rastorguev - My Home Page
• Jupiter Outer Satellite Orbit Ephemerides.
• Anna Mel'nik - Description of the catalog