... О UNИX . ... LibraryGnomeOrg_Evolution . Неизменяемая страница . ... Прикрепленные файлы . Другие действия: Показать разметку Вид для печати Сформатировать как Docbook Очистить кэш страницы ------------------------ Проверить правописание Похожие страницы Карта окрестностей ------------------------ Переименовать страницу Удалить страницу ------------------------ Подписать пользователя ------------------------ Очистить от спама Вернуть эту версию Страницы пакета Синхронизировать ...

Еще в разделе: (Показать все результаты (>46) - uneex.mithril.cs.msu.su/ )

• Index of /static/LibraryGnomeOrg_Evolution
• Index of /static/LibraryGnomeOrg_Evolution/figures

... Gas evolution from Brazilian rock crystal and quartz as raw materials for producing silica glass . ... Gas content, along with the content of element impurities and the content of mineral inclusions, is one of the most important characteristics of quality for quartz raw materials in producing high-quality silica glass. Gas evolution from rock crystal and vein quartz from Brazil as quartz raw materials for producing high-quality silica glass has been studied. ...

Еще в разделе: (Показать все результаты (>23) - www.kge.msu.ru/ )

... WORKSHOP "STELLAR ATMOSPHERES" . THE CHEMICAL AND DYNAMIC EVOLUTION OF STARS AND GALAXIES" . ... Chernomorka , Odessa , Ukraine . ... Modeling and interpretation of the stellar spectra of the usual and peculiar stars. Elemental abundances in the stars of different types and populations of the Galaxy. Chemical evolution of the stars and galaxies. ... Andrievsky S.M. (OAO ONU, Odessa, Ukraine) . ... CHEMICAL and DYNAMIC EVOLUTION STARS and GALAXIES" . ... Odessa mailto:astro@paco.odessa.ua . ...

Еще в разделе: (Показать все результаты (>76) - sai.msu.ru/ )

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Re: Пятый чемпионат ГЗ по Pro Evolution Soccer! [ re: Anonymous ] . ... Re: Пятый чемпионат ГЗ по Pro Evolution Soccer! [ re: Walkman ] . ...

Еще в разделе: (Показать все результаты (>1042) - www.snto-msu.net/ )

• Evolution de l'Europe de l'an 1000 à 2005 - Public forum of MSU united
• Pro Evolution Soccer 2008 - Public forum of MSU united student networks
• Третий чемпионат ГЗ по Pro Evolution Soccer - Public forum of MSU united

. [ Войти ] . Главная -> Фильмы -> Dragonball Evolution . Пользователи . Демо . Деньги . Фильмы . Форум . Dragonball Evolution . Драконий жемчуг: Эволюция . США 2009 . отметить . Приключение . Фантастика . Триллер . Фэнтэзи . Боевик .

Еще в разделе: (Показать все результаты (>55) - kinfo.ru/ )

• X-Men: Evolution - Фильмы - Kinfo.ru
• Epoch II: Evolution - Фильмы - Kinfo.ru
• Underworld: Evolution - Фильмы - Kinfo.ru

. Главное меню . Введение . Введение в задачи практикума STEV . Ознакомление . Знакомство с устройством задачи STEV . Расчет моделей . Расчет моделей звезд и эволюционных треков . Задания . Учебные задания . Теория . Краткая теория расчета эволюции звезд . Наблюдения . Сравнение теоретических расчетов с наблюдениями . Литература . Рекомендованная литература .

Еще в разделе: (Показать все результаты (>24) - observ.pereplet.ru/ )

• Справка по STEV
• Обсерватория

. Name . Last Modified . Size . Type . Parent Directory / . - . Directory . ChangeLog . 2016-Apr-03 18:31:17 . 5.7K . application/octet-stream . ChangeLog-2015 . 2015-Nov-09 07:11:44 . 93.6K . application/octet-stream . Manifest . 2016-Apr-03 18:31:17 . 2.6K . application/octet-stream . evolution-3.18.5.1.ebuild . 2016-Mar-07 11:06:56 . 4.1K . text/plain . evolution-3.18.5.2.ebuild . 2016-Apr-03 15:39:49 . 4.1K . text/plain . metadata.xml . 2016-Jan-25 02:06:09 . 0.9K . text/xml . lighttpd/1.4.35

Еще в разделе: (Показать все результаты (>16230) - mirror.msu.net/ )

• Index of /pub/gentoo-portage/gnome-extra/evolution-data-server/
• Index of /pub/gentoo-portage/sec-policy/selinux-evolution/
• Index of /pub/gentoo-portage/dev-python/django-evolution/

... In the region of ferroelectric phase transition of Rb 2 ZnCl 4 crystals, the relaxation of incommensurate (soliton) structure (IS) transferred abruptly to a nonequilibrium state with uniaxial mechanical stress G has been studied. The evolution of IS was recorded by recording changes in the dielectric constant E along the Y axis. ... As a result the E, t-curves corresponding to different initial states intersect and further they follow again the time logarithmic law. ...

Еще в разделе: (Показать все результаты (>84) - scon155.phys.msu.su/ )

... 2012 March 20 . Evolution of the Moon . Video Credit: LRO , SVC , NASA . ... The Moon was likely created from debris expelled when a Mars-sized object violently impacted the Earth about 4.5 billion years ago. ... Rocks large and small continued to impact the surface, including a particularly large impact that created Aitken Basin about 4.3 billion years ago. ... Over the next few billion years lava flowed into Earth-side basins , eventually cooling into the dark maria we see today. ...

Еще в разделе: (Показать все результаты (>1055) - www.sai.msu.su/ )

• APOD: 2007 March 5 - Illusion and Evolution in Galaxy Cluster Abell 2667
• SAL- Parallel Computing - Programming Languages Systems - esep
• SN 1997ef.

Astronomy Picture of the Day . Evolution of the Moon . ... Credit Copyright: LRO , SVC , NASA Explanation: What is the history of the Moon? The Moon was likely created from debris expelled when a Mars-sized object violently impacted the Earth about 4.5 billion years ago. ... Rocks large and small continued to impact the surface, including a particularly large impact that created Aitken Basin about 4.3 billion years ago. ... Publications with keywords: Moon . Publications with words: Moon . ...

Еще в разделе: (Показать все результаты (>5335) - www.astronet.ru/ )

• Illusion and Evolution in Galaxy Cluster Abell 2667
• Астронет > Illusion and Evolution in Galaxy Cluster Abell 2667
• Астронет > Международная конференция "Putting A Stars into Context: Evolution,

KEYWORDS: language evolution, mathematical modelling, branching processes . ... 2 Basic assumptions. ... Dying out, giving birth, and preserving of sign's meanings. ... Modelling of language evolution should be based on some assumptions concerning its micro-level, i.e. level of its micro-units' development. ... That is why it has become the starting point in the building of the mathematical model for the development in time and synchronic correlation of the whole system of a sign's features. ...

Еще в разделе: (Показать все результаты (>77) - old.philol.msu.ru/ )

• Konferences
• МГУ-ЛОКЛЛ:: Библиография основных работ А.А. Поликарпова за последние годы
• MSU-LGCLL:: Anatoliy A.Polikarpov - Semasiological and Word-formational

... Геология >> Геотектоника | ... Добавить новое сообщение . ... Красильников А.С. , Галкин В.А., Базилевский А.Т. Тектоника и эволюция венцов на Венере. ... Красильников А.С. Тектоническое строение, классификация и эволюция арахноидов на Венере. ... Новы и арахноиды на Венере: геологическое строение, классификация и эволюция . Новы и арахноиды на Венере: геологическое строение, классификация и эволюция: Новы и арахноиды на Венере: геологическое строение, классификация и эволюция . ...

Еще в разделе: (Показать все результаты (>706) - geo.web.ru/ )

• Informal geological society (RSG SG )
• Abstract
• Ссылки на сейсмотомографические сайты

... The Evolution of the Russian Tax System in the 19thcentury, . ... Ezhegodnik (Economic Hystory. ... 2002 , Moscow: ROSSPEN, 2003, p.345-383. ... The article deals with the history of the taxes of the Russian empire in the 19th century. ... Despite of the lag with the European model which consisted in the absence of income taxation, the Russian tax system had provided the budget with monetary resources, that were necessary for the financial stability of the Empire. ...

Еще в разделе: (Показать все результаты (>111) - hist.msu.ru/ )

• Project "The Labour Relations Evolution in Russian Industries"

... Для исследования была взята последовательность белка Malk_ecoli . ... Identities = 214/326 (65%), Positives = 257/326 (78%), Gaps = 13/326 (3%) Query 1 LRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGA 60 LR IAGLE ITSGDLFIGE+RMND P++RGVGMVFQSYALYPHL++ +NMSFGLKL+ A Sbjct 46 LRCIAGLEDITSGDLFIGEQRMNDVEPSKRGVGMVFQSYALYPHLNLYDNMSFGLKLSKA 105 Query 61 KKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLD 120 K I +RV+ AE+LQL+HLLDR+PKALSGGQRQRVAIGRTLV++P+VFLLDEPLSNLD ...

Еще в разделе: (Показать все результаты (>400) - kodomo.cmm.msu.ru/ )

• Practice1(evolution)
• evolution
• Gene Evolution Reconstruction

... Kandiano E. History of ice-rafting and water mass evolution at the northern Siberian continental margin (Laptev Sea) during Late Glacial and Holocene times // Quaternary Science Reviews, 2010, v.29 27-28. p. 3919-3935. ... Since seasonal sea ice cover is a permanent feature in this high Arctic region the prominent IRD-rich intervals in the oldest (>15.4 ka) and youngest (<7.2 ka) sediment units are attributed to iceberg-rafting. ... Correlation of the Late Holocene IRD peaks 5. ...

Еще в разделе: (Показать все результаты (>259) - www.geogr.msu.ru/ )

• http://www.geogr.msu.ru/structure/labs/notl/personal/Abstracts/Taldenkova_ea_GloPlaCha_2005.pdf
• Новый год новым годом

... Home News Program Committee Organizing Committee Program Plenaries Special Sessions Registration Abstracts Accommodation Important dates Contacts Poster Links Conference Venue Video . Preliminary List of Plenary Talks . ... On mathematical creative work of L.S. Pontryagin . ... Aeroelastic wing flutter LCO as a Hopf bifurcation point for a nonlinear convolution/evolution equation in a Hilbert space Abstract (PDF) . ... On the control of Liouville equations Abstract (PDF) . ...

Еще в разделе: (Показать все результаты (>65) - pont2008.cmc.msu.ru/ )

• Abstracts International Conference Differential Equations and Topology
• Ожидаемые пленарные доклады Международная конференция Дифференциальные
• International Conference Differential Equations and Topology dedicated to the

... 10.00 . Registration and morning coffee . ... Genomic analysis of the respiration the microbiota of human intestine . ... Coffee break . ... Lunch break . ... Morning coffee . ... NPG-explorer: a new tool for nucleotide pangenome construction and analysis of closely related prokaryotic genomes . ... Selection pressure on breast cancer somatic mutations revealed by bioinformatics sequence analysis . ... Analysis of variation in 3000 rice genomes project . ... MCCMB'15, 2015 ...

Еще в разделе: (Показать все результаты (>222) - mccmb.belozersky.msu.ru/ )

• MCCMB'13

... Surface plasmon-polaritons (SPPs) is a collective oscillation of light and electrons that propagate at the boundary between metal and dielectric. ... Ultrafast Laser Pulse Shaping by Plasmonic Crystals . In our group, controllable reshaping of a femtosecond laser pulse reflected from a plasmonic crystal based on 1D polymer grating with period of 750 nm covered by 50 nm silver film. ... Pulse duration ? ... nonlinear crystal. ... Ultrafast Polarization Pulse Shaping with Plasmonic Crystals . ...

Еще в разделе: (Показать все результаты (>79) - nanolab.phys.msu.ru/ )

• Frolov Aleksandr Yurievich | Laboratory of Nanophotonics & Metamaterials
• Vabishchevich Polina Petrovna | Laboratory of Nanophotonics & Metamaterials
• Ultrafast magnetophotonics | Laboratory of Nanophotonics & Metamaterials

... It is shown that behavior of optical pulse relative to AML signal in stable generation region is sufficiently depends on AML frequency detuning: while forming, pulse can obtain 1ns delay and even more. ... It is noted that borders of stable generation region are asymmetric relative to AML frequency with constant pulse delay. Velocity of delay increasing is different for positive and negative AML frequency detuning. ...

Еще в разделе: (Показать все результаты (>282) - ofvp.phys.msu.ru/ )

• Публикация
• Grant detail

... Continental Lithosphere Beneath SE Brazil . ... CREST (Continental Rifts: Evolution, Structure and Tectonics) Project . Crust and Upper Mantle Structure of S. California . ... Surface wave dispersion and upper mantle structure beneath southern Germany . ... Tomographic P-wave velocity inversion for the crust and upper mantle structure beneath Alaska . ... Upper Mantle Velocity and Q Structure . ... Velocity structure and anisotropy of the crust and upper mantle in the Brooks Range, Alaska . ...

Еще в разделе: (Показать все результаты (>19) - sbmg.geol.msu.ru/ )

• Europrobe2