... A.V. Eliseev . ... V.V. Adushkin, A.V. Vityazev, D.O. Glazachev, G.V. Pechernikova . Exogenous factors in the evolution of the Earth. ... Cosmic rays as a factor of biospheric evolution . ... A.V. Yakushev, N.A. Churilin, V.S. Soina, A.G. Kudinova, E.A. Vorobyova, N.S. Mergelov . ...

Еще в разделе: (Показать все результаты (>76) - comet.sai.msu.ru/ )

• Dm. Bizyaev's Publications
• IAC, Evolution of Galaxies, Conference
• Acknowledgments

. [ Войти ] . Главная -> Фильмы -> Dragonball Evolution . Пользователи . Демо . Деньги . Фильмы . Форум . Dragonball Evolution . Драконий жемчуг: Эволюция . США 2009 . отметить . Приключение . Фантастика . Триллер . Фэнтэзи . Боевик .

Еще в разделе: (Показать все результаты (>84) - kinfo.ru/ )

• X-Men: Evolution - Фильмы - Kinfo.ru
• Epoch II: Evolution - Фильмы - Kinfo.ru
• Underworld: Evolution - Фильмы - Kinfo.ru

. Name . Last Modified . Size . Type . Parent Directory / . - . Directory . ChangeLog . 2016-Apr-03 18:31:17 . 5.7K . application/octet-stream . ChangeLog-2015 . 2015-Nov-09 07:11:44 . 93.6K . application/octet-stream . Manifest . 2016-Apr-03 18:31:17 . 2.6K . application/octet-stream . evolution-3.18.5.1.ebuild . 2016-Mar-07 11:06:56 . 4.1K . text/plain . evolution-3.18.5.2.ebuild . 2016-Apr-03 15:39:49 . 4.1K . text/plain . metadata.xml . 2016-Jan-25 02:06:09 . 0.9K . text/xml . lighttpd/1.4.35

Еще в разделе: (Показать все результаты (>14037) - mirror.msu.net/ )

• Index of /pub/gentoo-portage/gnome-extra/evolution-data-server/
• Index of /pub/gentoo-portage/sec-policy/selinux-evolution/
• Index of /pub/gentoo-portage/dev-python/django-evolution/

... Criteria of branch quality . As it was repeatedly told , phylogenetic trees consist from branches. ... I. e., those positions, which can separate sequences of the branch from other sequences in the alignment. ... Measure of branch separation . ... Here and further: A - branch of the tree, i , j - sequences of alignment . ... That's why number of conserved positions in some branch should be considered in complex with the distribution of conserved positions in the whole alignment. ...

Еще в разделе: (Показать все результаты (>5490) - monkey.belozersky.msu.ru/ )

• ETS_3D_conservation
• S publications
• Hydrophobic clusters

... Для исследования была взята последовательность белка Malk_ecoli . ... Identities = 214/326 (65%), Positives = 257/326 (78%), Gaps = 13/326 (3%) Query 1 LRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGA 60 LR IAGLE ITSGDLFIGE+RMND P++RGVGMVFQSYALYPHL++ +NMSFGLKL+ A Sbjct 46 LRCIAGLEDITSGDLFIGEQRMNDVEPSKRGVGMVFQSYALYPHLNLYDNMSFGLKLSKA 105 Query 61 KKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLD 120 K I +RV+ AE+LQL+HLLDR+PKALSGGQRQRVAIGRTLV++P+VFLLDEPLSNLD ...

Еще в разделе: (Показать все результаты (>2360) - kodomo.cmm.msu.ru/ )

• Practice1(evolution)
• evolution
• Gene Evolution Reconstruction

... 2015 . ... Submit your article . ... This paper tries to emphasize how international insolvency law and national insolvency law have changed. Analyzing recent insolvency law development it is possible to discover new tendencies: Insolvency law aside being envisaged as a tool for compensating creditors interests, now it is arising as an instrument for rescuing companies. ... Insolvency, bankruptcy, turnaround, company intrinsic value, international insolvency law, European Union countries. ...

Еще в разделе: (Показать все результаты (>270) - ee-journal.spa.msu.ru/ )

There are three foredeeps in the foreland of the Great Caucasus: West-Kubanian, East-Kubanian and Terek-Caspian, located in the back-side of the folded structures of the Great Caucasus. ... Lifted edge of the plate appeared divided on blocks like "piano keys". Simplified model: . The dynamic of each block is defined by the balance of gravity, restoring force, friction force from the nearby blocks and viscous resistance forces. ... To see the dynamic of the system (animated GIF-file, 285 Kb) . ...

Еще в разделе: (Показать все результаты (>29) - dynamo.geol.msu.ru/ )

• V.Zakharov's Ph.D. thesis

... Geography of World Economy . ... Cryolithology and Glaciology . ... Departments . ... Research laboratories . ... Field stations . ... Type of field courses . ... Department of Cryolithology and Glaciology The Department was founded in 1945 with the name Department of northern countries . ... Our students are active members of PYRN (Permafrost Young Researchers Network), in which they share best practices, information about conferences, field courses, jobs. ... ISBN 5-89176-095-9 . ...

Еще в разделе: (Показать все результаты (>110) - eng.geogr.msu.ru/ )

• Research laboratory of recent sediments and pleistocene paleogeography
• Recreational Geography and Tourism
• Department of Physical Geography and Landscape Science

... The last stand before MAP: cosmological parameters from lensing, CMB and galaxy clustering" astro-ph/0212417 . ... Скопления галактик: J. Patrick Henry "Evolution of the X-ray Properties of Clusters of Galaxies" astro-ph/0207148 . ... Supernova Explosions and Neutron Star Formation" astro-ph/0103015 . ... Рентгеновские источники в шаровых скоплениях: Frank Verbunt "Binary evolution and neutron stars in globular clusters" astro-ph/0210057 . ... Neutrino Emission from Neutron Stars" astro-ph/0012122 ....

Еще в разделе: (Показать все результаты (>487) - astro.uni-altai.ru/ )

• http://xray.sai.msu.ru/~polar/sci_rev/1403.html
• http://xray.sai.msu.ru/~polar/sci_rev/0609.html
• http://xray.sai.msu.ru/~polar/sci_rev/0305.html

... As the author of a famous textbook on physical chemistry and electrochemistry (the first edition in 1902), Kablukov far advanced the popularity of electrochemical science in our country. ... Professor Shpital'skii also organized the studies of hydrogen and oxygen evolution on platinum electrodes by means of a specially developed commutator method. ... Young A.N.Frumkin In 1930, A.N Frumkin (1895-1976) became the head of the Laboratory of Engineering Electrochemistry at Moscow State University. ...

Еще в разделе: (Показать все результаты (>110) - electr003.chem.msu.ru/ )

• Laboratory of Electrochemical energetics
• Boris I. Podlovchenko: Selected Publications

... This family contains a protein with resolved 3D structure: Q8UK99_AGRT5/3-102 , pdb ID: 1vqy . SDPsite predicts following important positions (numbering corresponds to 1vqy ): . ... 90S, 55W . ... 76W, 8Y, 46G, 55W, 39G, 63R . ... 8Y, 39G, 55W, 63R, 76W, 90S . ... Mapping predictions onto structure of 1vqy : . Associated grouping: . Group 1 . Q7ZWJ6_BRARE/154-253 . Q6DJ76_XENTR/154-253 . ... NPS3B_HUMAN/146-245 . ...

Еще в разделе: (Показать все результаты (>134) - bioinf.fbb.msu.ru/ )

• SDPsite - PF01398
• SDPsite - PF01722
• SDPsite - PF01205

... Sergey V. Borisov . ... Kaplan A.Ya ., Borisov S.V. , Zheligovsky V.A. Classification of EEG's of adolescents based on spectral and segment parameters for the purposes of schizophrenia diagnostics // Biological Psychiatry, 2005 (ISSN 0006-3223), submitted . Borisov S.V. , Kaplan A.Ya ., Gorbachevskaya N.L., Kozlova I.A. Structural organization of the EEG alpha activity in adolescents with schizophrenic spectrum disorders // Zh . ... Borisov S.V. , Gorbachevskaya N.L., Kaplan A.Ya . ...

Еще в разделе: (Показать все результаты (>61) - brain.bio.msu.ru/ )

• Change-points in EEG components with different pattern
• Change-points in multi-channel EEG

... file . ... file log . ... To implement this optimization methods supeimpose and save_pdb of alignment were replaced with methods with same names of sequence. ... 1 Using library in-place . ... 18 NEWS file . ... 21 NEWS file contains news that are important to the library users, not to the . ... It must contain a word abot every change in any interfaces. ... 23 contain a word about bugfix, if that bugfix was important and could cause users . ... 38 * change(!): critical library interface change . ...

Еще в разделе: (Показать все результаты (>12853) - kodomo.fbb.msu.ru/ )

• allpy: d137df18a8bf README.devel
• allpy: README.devel annotate
• allpy: 6134ae1dfdae README.devel

. Structure of loops for many protein families change gradually in evolution. %Id = 73% %Id = 53% %Id = 26% . Evolutionary plasticity of loops ( bloop ) is higher than EP of cores ( bcore)

Еще в разделе: (Показать все результаты (>45) - ecology.genebee.msu.ru/ )

... 2007, ApJ Shocks are vital for explaining light of those superluminous events for many months... 15y12-Prosper ­ p. 4 SNR Tycho in X-rays (Chandra) ...and thousands of years in SNRs 15y12-Prosper ­ p. 5 Supernova : order of events Core collapse (CC) or explosion 15y12-Prosper ­ p. 6 Supernova : order of events Core collapse (CC) or explosion Neutrino /GW signal, accompanying signals ... Gravitational waves? 15y12-Prosper ­ p. 12 First messengers of explosions Neutrino? ...

Еще в разделе: (Показать все результаты (>239) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/mirrors/2001_7.pdf
• http://nuclphys.sinp.msu.ru/nseminar/24.05.11.pdf
• http://nuclphys.sinp.msu.ru/school/s08/s08_39.pdf

... Research objects and scientific purposes . Space scientific program includes development and launch of two supersmall spacecrafts "Universitetskiy" and "Kompas-2" intended for monitoring of radiation conditions near the Earth. ... All the studies conducted in the near-Earth space are characterised by strong radiation fields. ... The circular polar orbits, which cover all the near-Earth space, are the most favorable for comprehensive studies of the radiation conditions near the Earth. ...

Еще в разделе: (Показать все результаты (>50) - cosmos.msu.ru/ )

Projects . ... Modeling the tmRNA structure in the ribosome . For modeling of the tmRNA-2 structure in the ribosome we used the published ribosome X-ray structure with a defined mRNA path (Yusupova et al, 2006). ... Since the arch consisting of tmRNA pseudoknots and helices was observed by cryo-EM in the pre-initiation complex (Valle et al, 2003) as well as in the tmRNA-4 complex described here, we suggest that such a structure should be present at all steps of the tmRNA path through the ribosome. ...

Еще в разделе: (Показать все результаты (>30646) - dualopt1.cmm.msu.ru/ )

PHYSICS OF FLUIDS 19, 061702 2007 The wimple : A rippled deformation of a wetting film during its drainage Vladimir S. Ajaev Department of Mathematics, Southern Methodist University, Dallas, Texas 75275 Roumen Tsekov ... Russia Received 27 February 2007; accepted 24 April 2007; published online 19 June 2007 It has long been accepted that hydrodynamic pressure in a draining fluid film can cause inversion of curvature of a fluid-fluid interface, creating the so-called ... 5 FIG. ...

Еще в разделе: (Показать все результаты (>46) - nanofluidics.phys.msu.ru/ )

• http://nanofluidics.phys.msu.ru/paper/derjaguin.pdf
• http://nanofluidics.phys.msu.ru/paper/la0508588.pdf

... Applications of Molecular Mechanics to Metal Complexes" . ... Molecular mechanics study of the mixed-ligand lanthanide complexes using Gillespie-Kepert model . ... Within MM-GK, the same parameters are applicable to complexes of different coordination numbers/polyhedra. ... Gillespie-Kepert model . ... Using derived computational parameters, we calculated the geometry of 39 lanthanide ion nonaaqua complexes, 6 octaaqua complexes and 18 beta- diketonate and aqua-beta-diketonate complexes. ...

Еще в разделе: (Показать все результаты (>29) - analyt.chem.msu.ru/ )

... Experiments and computer simulations of low-energy boron monomers and decaborane clusters implantation were performed. Molecular dynamics simulations of B10 cluster implantation have shown similar implant depth but different damage density and damage structure compared to monomer (B1 ) ion implantation with the same energy-per-atom. ... Therefore, the depth profile of B atoms by cluster implantation was the same as that by B monomer ions at the same energy per atom. ...

Еще в разделе: (Показать все результаты (>132) - danp.sinp.msu.ru/ )

• Scattering