filter1d - Time domain filtering of 1-D time series filter1d [ infile ] -F < type >< width > [ -D increment ] [ -E ] [ -H [ nrec ] ] [ -I ignore _ val ] [ -L lack _ width ] [ -N n _ cols / t _ col ] [ -Q q _ factor ] [ -S symmetry _ factor ] [ -T start / stop / int ] [ -V ] [ -bi [ s ][ n ] ] [ -bo [ s ] ] filter1d is a general time domain filter for multiple column time series data. The user specifies the number of columns of input and which column is the time. ...

Еще в разделе: (Показать все результаты (>330) - xray.sai.msu.ru/ )

• http://xray.sai.msu.ru/~ivan/gmt/man/grdcut.html
• http://xray.sai.msu.ru/~ivan/gmt/man/grdpaste.html
• http://xray.sai.msu.ru/~ivan/gmt/man/fitcircle.html

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>170) - tukachev.flogiston.ru/ )

• Category: Новости

... Alders ( Alnus Mill.) are the common trees in Europe and Asia, and there are some taxonomically interesting forms on the border of the area. ... We have checked mentioned hypotheses using multivariate methods based on classic morphometrics data and two variants of geometric morphometrics of alder leaf. ... On the contrary, A. barbata must be considered as separate species. Our data show that the results of geometric morphometrics and classic morphometrics could be significantly different. ...

Еще в разделе: (Показать все результаты (>188) - herba.msu.ru/ )

... Second set contains blast hits of the contig or the chromosome search against protein database, for example, Uniref90. ... Hit color corresponds to reading frame in the contig, color intensity is grteater than intensities of exons. ... Reading frame of five blast hits in the third exon of gene g4 are different than exon's reading frame . Blast hits in gene g3 located on reverse strand do not match reading frames of the 1st and 3rd exons and overlap 1-2 and 2-3 introns . ...

Еще в разделе: (Показать все результаты (>40) - mouse.belozersky.msu.ru/ )

• Alignment example
• Example of alignment
• Geometrical core

Электронная библиотека Попечительского совета . ... Quigley E. - UNIX Shells by Example . ... Название: UNIX Shells by Example . ... UNIX Shells by Example, Third Edition adds thorough coverage of the new bash and tcsh shells to the full explanations in Quigley's famous treatment of the C, Bourne, and Korn shells and the awk, sed, and grep utilities, making this the most complete UNIX shell programming book available anywhere. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>12751) - lib.mexmat.ru/ )

• Onion F. - Essential ASP.NET With Examples in C# :: Электронная библиотека
• Butzon T. - PHP by Example :: Электронная библиотека попечительского совета
• Hyde J. - USB design by example :: Электронная библиотека попечительского

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>58) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• TRF_2d. Page 3.

Myotis . Uropatagium venation pattern in bats as diagnostic character (by the example of genus Myotis ) . ... By the example of genus Myotis it was shown that venation pattern on uropatagium of bats in some cases can be used as diagnostic character. Venation features on uropatagium allow easy to separate Daubentonв?Ts bat, eastern water bat, big-footed bat, and pond bat from Brandtв?Ts bat, Siberian bat, whiskered bat, and Ikonnikovв?Ts bat. ... Bats]. ... Bats of the Russian Far East]. ...

Еще в разделе: (Показать все результаты (>992) - zmmu.msu.ru/ )

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . Институт проблем экологии и эволюции им. А.Н. Северцова РАН . Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: example, level Chinese luxury cosmetics b . ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...

Еще в разделе: (Показать все результаты (>3448) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: on the will example, refine
• Экологический Форум - Фундаментальная Экология: example, IWC such I is States.
• Экологический Форум - Фундаментальная Экология: center China. the example, the

... NetCDF User's Guide for C . ... more standard error behavior, by uniformly communicating an error status back to the calling program in the return value of each function. ... We are hoping that the benefits of the new interface will be an incentive to use it in new netCDF applications. ... The new interface handles errors differently than netCDF-2. ... Where the netCDF-2 interface used NC_LONG to identify an external data type corresponding to 32-bit integers, the new interface uses NC_INT instead. ...

Еще в разделе: (Показать все результаты (>122) - angel.cs.msu.su/ )

• Appendix A Units
• ExtensionFileFilter

... Algorithm & . Format requirements . Contact us . Gallery of examples . SDPsite was applied to 124 families fron the Pfam database . ...

Еще в разделе: (Показать все результаты (>136) - bioinf.fbb.msu.ru/ )

• Alignment example
• User's guide
• SDPsite - Algorithm Format requirements

... Structure of Data . ... Catalog . ... The SAI OCL Catalog site provides several VO-enabled modes of operation: . VO-enabled catalog data analysis from a browser . ... Endpoint URL is http://ocl.sai.msu.ru/catalog/conesearch/ . ... VO-enabled catalog analysis from a browser . Presently, this recipe works with Firefox (Windows, MacOS, Linux), Internet Explorer (Windows) and Opera (Windows) browsers with Java plugin 1.6 installed. ... Main TOPCAT window with SAI OCL catalog loaded will appear. ...

Еще в разделе: (Показать все результаты (>2) - ocl.sai.msu.ru/ )

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>150) - monkey.belozersky.msu.ru/ )

• Example of supporting positions
• SDPpred
• SCOP famyli:

О лаборатории . ... Лаборатория теоретической биофизики . ... The manual to FireFly program clearly explain why and how to use spherical or cartesian functions when working with different basis sets. ... The $D5 group provides further control through the D5, F7, and G9 keywords, which pertain to d, f, and g functions, respectively. ... Quantum chemistry information page ERG Research Group: Лаборатория теоретической биофизики написал (Май 19th, 2015 5:52 пп) . ... 2014 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>33) - erg.biophys.msu.ru/ )

• All-atom automatic OPLS-AA topology generator ERG Research Group: Лаборатория
• Firefly ERG Research Group: Лаборатория теоретической биофизики
• Peter Mamonov ERG Research Group: Лаборатория теоретической биофизики

GSK-3 Inhibitors: The Dataset . ... We suppose that it will be useful for the other researchers in the field of chemoinformatics; the main peculiarity of this Dataset is wide activity range of compounds and significant diversity of the actives (true inhibitors). ... IC50 is given in nM (sic!) according to the data reported in the article. It's a text field (as well as the other raw activity data fields) and values like '>10000' are given for inactive compounds. ...

Еще в разделе: (Показать все результаты (>3) - qsar.chem.msu.ru/ )

A MINIMALIST APPROACH TO DP-INTERNAL SCRAMBLING IN RUSSIAN GOAL: We study Russian DP-internal scrambling analyzing it to the edge of a DP-phase whereby the scrambled element cyclically up to the highest phase where it checks a pragmatic additional evidence in favour of the 'strict' version of the Phase as instances of movement of an element escapes the nominal domain and raisig ([+F], [+topic]) feature. ... Scrambled-DP word order) `I washed the red socks.' ...

Еще в разделе: (Показать все результаты (>243) - www.philol.msu.ru/ )

• LangueDOC :: Archi :: Alphabet
• Title: Russian Language Training via INTERNET. Internet-based educational

... Corporate Social Policy as an Approach to Managing the Workforce: Some Examples from U. S. History, . ... Corporate social policy is one of the most significant subjects studied by business historians. To attract workers and maintain sound businesses some Russian entrepreneurs adopted paternalistic social welfare policies, described in several recently published works. ...

Еще в разделе: (Показать все результаты (>110) - hist.msu.ru/ )

... This applet generates an observing list based on an observer's location and time. ... To use this program, enter in your location, and the local times at which you wish to begin and end observing. The date you enter should correspond to the calendar day at the time at which you begin observing. For example, if you wish to observe from 9:37 PM October 23, 2007 until 3:21 AM October 24, 2007, you would enter 21:37 for the starting time, 03:21 for the finish time, and 10/23/2007 for the date. ...

Еще в разделе: (Показать все результаты (>17) - observ.pereplet.ru/ )

• MASTER GLOBAL ROBOTIC TELESCOPES NET

... 2015 . ... The article analyzes the existing methods of investment climate evaluation. The author also proposes a new method, the factorial estimation of investment climate, developed by the author on the basis of the analysis of investment appeal, investment activity and efficiency of investment activity. ... Investments, evaluation method, investment climate, investment activity, investment appeal, efficiency of investment activity . ... Public Administrarion". ... Copyright ї 2015 SPA MSU . ...

Еще в разделе: (Показать все результаты (>150) - ee-journal.spa.msu.ru/ )

... VaST is a software tool for finding variable objects on a series of astronomical images. ... VaST performs object detection and aperture photometry using SExtractor on each image, cross-matches lists of detected stars, performs magnitude calibration with respect to the first (reference) image and constructs a lightcurve for each object. ... VaST FITS image viewer ./pgfv . ... Part I" PZP, vol. ... K. V. Sokolovsky, S. A. Korotkiy; "New Variable Stars Discovered by the NMW Survey" PZP, vol. ...