We have prepared some summation programs for working with Reduce output. ... 1 in $COMPHEP/test/sum.red $ % loading the summation package in symb1.red $ % reading contributions of diagrams sum; % writing the answer (32*ee**4*(2* p1.p2 **4-4* p1.p2 **3* p1.p3 +3* p1.p2 **2* p1.p3 **2-2* p1.p2 **2* p1.p3 *me**2-p1.p2* p1.p3 **3 + 2* p1.p2 * p1.p3 **2*me**2 + p1.p3 **2*me**4)) /(propden(-p1-p2,me,0)**2*propden(p2-p3,me,0)**2)$ %2 in $COMPHEP/test/sum2pole.red $ % loading the ...

Еще в разделе: (Показать все результаты (>1216) - theory.sinp.msu.ru/ )

• fc3:dokuwiki:example [THEP]
• Examples

. PQ web form . PQ reduced web form . TALSN GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLQRNHYWKPTINL DKLWSLVPEETREKYVAGNAPSDKAIVLDLLSLGYAKVLGKGRLPEVPIVVKARYVSKEA ERKIKEAGGVIELV .

Еще в разделе: (Показать все результаты (>16) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Geometrical core
• PLANdbAffy: probe-level annotation database for Affymetrix expression

Search: . ... About Trac . ... Previous Revision . Latest Revision . Next Revision . ... Revision Log . View revision: . ... Revision 57:2f62804e21fc , 517 bytes checked in by Daniil Alexeyevsky <me.dendik@тАж>, 5 years ago ( diff ) . Added example snake . ... snake Example . ... Rule 1: chase enemy tail . ... Rule 2: stick to walls . ... Powered by Trac 0.12.5 . ... Visit the Trac open source project at . http://trac.edgewall.org/ ...

Еще в разделе: (Показать все результаты (>1391) - kodomo.cmm.msu.ru/ )

• Help: templating
• TracNotification тАУ Tanchiki
• Department of animal cell biochemistry - Staff and contacts

... help . find changesets by author, revision, files, or words in the commit message Template Usage Mercurial allows you to customize output of commands through templates. ... Usage: $ hg log -r1 --style changelog A template is a piece of text, with markup to invoke variable expansion: $ hg log -r1 --template "{node}\n" b56ce7b07c52de7d5fd79fb89701ea538af65746 Strings in curly braces are called keywords. ... The changeset bisection status. bookmarks List of strings. ...

Еще в разделе: (Показать все результаты (>11225) - kodomo.fbb.msu.ru/ )

• Index of /FBB/year_06/term1/Pr_7/Examples

... Algorithm & . Format requirements . Contact us . Gallery of examples . SDPsite was applied to 124 families fron the Pfam database . ...

Еще в разделе: (Показать все результаты (>135) - bioinf.fbb.msu.ru/ )

• Alignment example
• User's guide
• Input Formats

Myotis . Uropatagium venation pattern in bats as diagnostic character (by the example of genus Myotis ) . ... By the example of genus Myotis it was shown that venation pattern on uropatagium of bats in some cases can be used as diagnostic character. Venation features on uropatagium allow easy to separate Daubentonв?Ts bat, eastern water bat, big-footed bat, and pond bat from Brandtв?Ts bat, Siberian bat, whiskered bat, and Ikonnikovв?Ts bat. ... Bats]. ... Bats of the Russian Far East]. ...

Еще в разделе: (Показать все результаты (>674) - zmmu.msu.ru/ )

• XIV International Ornithological Conference of North Eurasia: Abstracts

... Home > Scientific laboratories > IM . ... The Laboratory of Industrial Mathematics (LIM) headed by Professor V.M. Goloviznin was established in the Faculty of Computational Mathematics and Cybernetics (CMC) of Lomonosov Moscow State University in 2011. ... In the area of energy and space, examples of topical engineering problems LIM is involved in, include the numerical simulation of new-generation atomic plants and computational aeroacoustics. ... Source URL: http://en.cs.msu.ru/laboratories/im . ...

Еще в разделе: (Показать все результаты (>259) - en.cs.msu.ru/ )

• Laboratory of Industrial Mathematics | CMC MSU
• Laboratory of Programming Technologies
• Research Laboratory of Computational Modeling Tools

... Query: E. coli K12 tRNA (valV, selC, asnV, leuT, argZ from EMBL entry U00096 ) . ... BLASTN (both) | ... Nhunt . ... BLASTN (optimal): 3.5 s . BLASTN (default): 0.8 s . ... Nhunt: 7 s The program Nhunt surpass all other tested programs in sensitivity. ... Nhunt BLASTN (optimal): 2.9 s . ... Nhunt: 3.7 s BLASTN with default parameters actually cannot find any significant homologues. ... Nhunt-3: 1.7 s BLASTN with default parameters actually cann't find any significant homologues. ...

Еще в разделе: (Показать все результаты (>15) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• ConClus
• Nhunt

... Corporate Social Policy as an Approach to Managing the Workforce: Some Examples from U. S. History, . ... Corporate social policy is one of the most significant subjects studied by business historians. To attract workers and maintain sound businesses some Russian entrepreneurs adopted paternalistic social welfare policies, described in several recently published works. ...

Еще в разделе: (Показать все результаты (>66) - hist.msu.ru/ )

Title Should Be in Bold, 18-Point Type and Centered, Please Use Title Case Author name(s) [10-point type, centered, bolded] Author affiliation and full address (8-point type, centered, italicized) Author e-mail address: (8-point type, centered, italicized) Abstract: Indent left and right margins 0.5 in. (1.27 cm), justify the paragraph (on both right and left), and use the same font as in the body of the paper. ... 5] Author(s), "Title of paper," in Title of Proceedings, Name(s), ed(s)., ...

Еще в разделе: (Показать все результаты (>10) - iconolat13.phys.msu.ru/ )

Alignment COG1325 . ... It is supported by 29 positions - that's written on the scheme. ... Such are positions number 5 ( leucine opposite isoleucine , valine and methyonine ), 30 ( glutamic acid opposite arginine , glycine and serine ), 51 ( threonine opposite alanine , phenylalanine and serine ), 55 ( phenylalanine opposite leucine , histidine and tyrosine ), 111 ( phenylalanine opposite isoleucine , leucine and valine ), 123 ( valine opposite isoleucine , ...

Еще в разделе: (Показать все результаты (>2208) - monkey.belozersky.msu.ru/ )

• SDP home page
• ETS numeration assumed
• SCOP famyli:

. [Назад к основному тексту]

Еще в разделе: (Показать все результаты (>271) - chem.msu.ru/ )

• Entrance Examinations - Preliminary Round
• Entrance Examinations - Main Round
• Department of Chemistry, Moscow State University

... YUI 2 Examples . ... Contains an un-archived and ready for use copy of YUI 2.8.0 - see http://developer.yahoo.com/yui . ... You do not need to install anything in the browser to use this extension. ... Select "Install". ... See http://foswiki.org/Support/ManuallyInstallingExtensions for more help. ... Copyright : . ... update to v2.8.0 and add v3.0.0 -- Foswiki:Main.AndrewJones . ... http://foswiki.org/Extensions/YahooUserInterfaceContrib . This topic: System > YahooUserInterfaceContrib . ...

Еще в разделе: (Показать все результаты (>2136) - wiki.cs.msu.ru/ )

• IncludeTopicsAndWebPages < System < Foswiki
• FootNotePlugin < System < Foswiki
• JQueryUITooltip < System < Foswiki

Online Services | ... Nuclear Wallet Cards" . USA National Nuclear Data Center - NNDC . ... Nuclei Selection: . All nuclei Only even Only odd . ... Decay Type: . decay . ... CDFE Head: Vladimir V. Varlamov . ...

Еще в разделе: (Показать все результаты (>18) - cdfe.sinp.msu.ru/ )

• CDFE => Online Services => Nucleus Ground State Parameters

grdfft - Perform mathematical operations on grdfiles in the frequency domain grdfft in _ grdfile -G out _ grdfile [ -A azimuth ] [ -C zlevel ] [ -D [ scale |g ] ] [ -E [ x|y ][ w ] ] [ -F [ x | ... The horizontal dimensions of the grdfiles are assumed to be in meters. ... Append a scale to multiply by (kr * scale ) instead. Alternatively, append g to indicate that your data are geoid heights in meters and output should be gravity anomalies in mGal. Default is no scale]. ...

Еще в разделе: (Показать все результаты (>338) - xray.sai.msu.ru/ )

• http://xray.sai.msu.ru/~ivan/gmt/man/grdproject.html
• http://xray.sai.msu.ru/~ivan/gmt/example19.html
• http://xray.sai.msu.ru/~ivan/gmt/example03.html

Lomonosov Moscow State University was established in 1755 . ... Lomonosov Moscow State University Diary . ... MSU Online . ... More than 40 000 students (graduate and postgraduate) and about 7 000 undergraduates study at the university, and over 5 000 specialists do the refresher course here. ... Moscow University campus is an extremely complex system, with its 1 000 000 m2 floor area in 1 000 buildings and structures, with its 8 dormitories housing over 12 000 students and 300 km of utility lines. ...

Еще в разделе: (Показать все результаты (>194) - www.msu.ru/ )

• School of Television
• Information for applicants
• Exchanges with Moscow University

University Satellites and . Space Science Education . ... News . ... Internet seminars as the new way of Inter-University Aerospace Centre activity . ... In such a dynamic field as remote sensing, the Internet resources already beat traditional libraries and image depositories. ... In 2000-2005 seven Internet-based seminars were held: "Obtaining satellite images over Internet". ... Images of new types. ... Skobeltsyn Institute of Nuclear Physics, Moscow State University, 2005-2006 . ...

Еще в разделе: (Показать все результаты (>6695) - cosmos.msu.ru/ )

ChangeLog for snakes # # Generated by Trac 0.12.5 # 04/11/16 22:55:00 Mon, 20 Dec 2010 14:01:39 GMT Daniil Alexeyevsky me.dendik@тАж [134:8e75e931bfd2] * snakes / example.snake ( modified ) example.snake : better rules for chasing enemy tail Mon, 20 Dec 2010 11:57:44 GMT Daniil Alexeyevsky me.dendik@тАж [121:06e4b4ea7596] * snakes / example.snake ( modified ) * ...

Еще в разделе: (Показать все результаты (>386) - kodomo.cmm.msu.su/ )

• http://kodomo.cmm.msu.su/trac/snake/log/snakes?format=changelog&rev=134%3A8e75e931bfd2&limit=100&mode=stop_on_copy
• http://kodomo.cmm.msu.su/trac/snake/log/snakes?format=changelog&rev=416418c9aaefbd75f3451a63f12d0ab8af3b89f3&limit=100&mode=stop_on_copy
• http://kodomo.cmm.msu.su/trac/snake/log/snakes?format=changelog&rev=360c297c05f3577ca730ecaf86131163456f6b73&limit=100&mode=stop_on_copy

... We live in the epoch of modern informational, scientific and intellectual technologies. Modern person, especially young one, cannot imagine life without computers, cellular phones and high-speed Internet. ... History has given a lesson - having splendid science, excellent education and highly organized society, having colossal resources, being a great power, we could not cope with the task - to build a prospering and just society. ... It demonstrates the colossal possibilities of modern science. ...

Еще в разделе: (Показать все результаты (>21) - www.rsr-online.ru/ )

... About lab . ... Online Journal "Computer graphics and multimedia" (in russian) . ... MSU Graphics & Media Lab (Video Group) . The filter is designed to suppress comb effect, also known as interlacing, in motion pictures. As opposed to other available filters, MSU Deinterlacing . ... The fragment processed by MSU Deinterlacing . ... The frame processed by MSU Deinterlacing . ... Frames from sequences tennis & mobl: AlparySoft, Decomb and MSU SMC deinterlacer. ... video@graphics.cs.msu.ru . ...

Еще в разделе: (Показать все результаты (>225) - graphics.cs.msu.ru/ )

• Removal of comb effect from video | Лаборатория компьютерной графики и
• Removing of blocking effect from video | Graphics and Media Lab
• Removing of blocking effect from video | Лаборатория компьютерной графики и