... An aliphatic ionene (2-10-ionene) has been selected as a modifier to prepare a novel polymer-coated packing material for capillary electrochromatography. The packing material was produced by dynamical modification of a commercially available sulfonated silica Exsil-100 SCX. Strong ion-exchange interactions in the capillary packed with ionene-modified sulfonated silica have been demonstrated by the example of the retention of p-aminobenzoic acid. ...

Еще в разделе: (Показать все результаты (>249) - chem.msu.ru/ )

• Moscow University Chemistry Bulletin Vol. 50, No. 5, P. 297 (2009)
• Moscow University Chemistry Bulletin Vol. 45, No. 1, P. 38 (2004)
• Moscow University Chemistry Bulletin Vol. 42, No. 1, P. 19 (2001)

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>54) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• Software for resistivity and induced polarization

... DNA chains . RNA chains . Protein chains . ... TRANSFERASE/DNA . ... dna . ... ANTIBIOTIC/DNA . ... TRANSCRIPTION/DNA . ... 1997-12-10 . ... VIRAL PROTEIN/RNA . ... rna . ... ISOMERASE/DNA . ... VIRUS/RNA . ... TRANSCRIPTION/RNA . ... VIRAL PROTEIN/DNA . ... HYDROLASE/DNA . ... RNA BINDING PROTEIN/RNA . ... DNA BINDING PROTEIN/DNA . ... TRANSFERASE/RNA . ... GENE REGULATION/DNA . ... GENE REGULATION/RNA . ... HYDROLASE/RNA . ... PROTEIN/DNA . ...

Еще в разделе: (Показать все результаты (>73) - monkey.belozersky.msu.ru/ )

• Example of supporting positions
• SDP home page
• NPIDB

NGS Data Analysis with Unipro UGENE Olga Golosova, Yuriy Vaskin, German Grekhov, Yuliya Algaer UNIPRO, Lavrentieva ave. ... That is where Unipro UGENE NGS framework comes in play. ... Moreover, the UGENE toolkit allows one to automate common tasks by creating workflows with the integrated tools using the UGENE Workflow Designer. Analysis of NGS data with UGENE may start, for example, from quality control of raw NGS data, received from a sequencing facility, with the integrated FastQC [3] tool. ...

Еще в разделе: (Показать все результаты (>141) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/4.pdf

. [ Войти ] . Главная -> Фильмы -> Available Men . Пользователи . Демо . Деньги . Фильмы . Форум . Available Men . США 2006 . отметить . Комедия .

Еще в разделе: (Показать все результаты (>110) - kinfo.ru/ )

• Wildly Available - Фильмы - Kinfo.ru
• Power Rangers Operation Over.. - Фильмы - Kinfo.ru
• Operation Dance Sensation - Фильмы - Kinfo.ru

... Class . ... Provides an abstraction for multidimensional array access, some concrete implementations, and ways to view a MultiArray as if it had a different structure. ... This interface defines the services required by MultiArrayProxy to manipulate indexes and the dimensions of a MultiArray. ... In the following, we use the unadorned term "array" to mean the Java language construct, and the term "multidimensional array" for the mathematical abstraction modeled by the MultiArray class in this...

Еще в разделе: (Показать все результаты (>42) - angel.cs.msu.su/ )

• Appendix A Units
• Index
• Appendix D NetCDF 2 C Transition Guide

The Octotron Approach: Towards Autonomous and Reliable Operation of Supercomputers Alexander Antonov, Dmitry Nikitenko, Pavel Shvets, Sergey Sobolev, Konstantin Stefanov, Vadim Voevodin, Vladimir Voevodin, Sergey Zhumatiy Research Computing Center, Lomonosov Moscow State University, Moscow, Russia {asa,dan,shpavel,sergeys,cstef,vadim,voevodin,serg}@parallel.ru 1 Introduction ... 2 The Octotron System: Model-based Approach Octotron represents the supercomputer model in the form of a graph (Fig. ...

Еще в разделе: (Показать все результаты (>30) - hpc.msu.ru/ )

• http://hpc.msu.ru/files/hpcmsu/downloads/X-Com_tutorial.pdf
• http://hpc.msu.ru/files/HPC/ISC_2015_Posters_submission_14.pdf
• http://hpc.msu.ru/files/HPC/X-Com_tutorial.pdf

. PQ web form . PQ reduced web form . TALSN GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLQRNHYWKPTINL DKLWSLVPEETREKYVAGNAPSDKAIVLDLLSLGYAKVLGKGRLPEVPIVVKARYVSKEA ERKIKEAGGVIELV .

Еще в разделе: (Показать все результаты (>16) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Geometrical core
• PLANdbAffy: probe-level annotation database for Affymetrix expression

. Information by your request is not available. This is ejudge contest administration system, version 3.5.1+ (GIT 2eb5ef0), compiled 2016-03-20 11:30:56. This program is copyright 2000-2016 Alexander Chernov. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation ; either version 2 of the License, or (at your option) any later version. Visual design and web-interface 2006-2016 Toto Lasvik .

Еще в разделе: (Показать все результаты (>12) - acm.msu.ru/ )

... Russian Pages . CDFE: Home Page . ... Numerical data, graphics, and bibliography . ... description] . Last updated: May 6th, 2014 . ... Last updated: June 15th, 2011 . ... Last updated: . ... Last updated: April 4th, 2015 . ... Last updated: February 25th, 2016 . ... Last updated: September 27th, 2011 . ... Photonuclear Data Index since 1955 . ... Last updated: September 15th, 2015 . ... Last updated: March 22th, 2010 . ... Last updated: March 19th, 2015 . ... Last updated: May 15th, 2002 . ...

Еще в разделе: (Показать все результаты (>25) - cdfe.sinp.msu.ru/ )

• CDFE => Online Services => Calculator and Graph Engine for Atomic Nuclei
• CDFE => Online Services => Relational ENSDF
• CDFE => Online Services => Nucleus Ground State Parameters

... Algorithm & . Format requirements . Contact us . Gallery of examples . SDPsite was applied to 124 families fron the Pfam database . ...

Еще в разделе: (Показать все результаты (>134) - bioinf.fbb.msu.ru/ )

• Alignment example
• User's guide

... Like ordinary make, metamake keeps platform-dependent files (object, executables, libraries) for repeated usage. To use the metamake, one must define basic project directories (task directory, target root, object directory etc) and prepare two simple files: task-file that contains common project settings (selected compilers, common system libraries etc) and architecture- independent Imake-file which includes project description along with compiler and linker directives. ...

Еще в разделе: (Показать все результаты (>59) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/news.html
• http://acat02.sinp.msu.ru/page0.html
• http://acat02.sinp.msu.ru/presentations/litinski/litinski.doc

... Using Intel Xeon Phi coprocessors for execution of natural join on compressed data" . ... This coprocessor uses distributed columnar indexes with interval fragmentation. The operation of the coprocessor engine is considered by an example of natural join processing. ... Keywords: columnar data representation, columnar indexes, database coprocessor, interval fragmentation, parallel database system, cluster computing systems with many-core accelerators, Intel Xeon Phi. ...

Еще в разделе: (Показать все результаты (>179) - num-meth.srcc.msu.ru/ )

• "Sets in the tool environment for developing program modules"
• "Transformation of problems of computational mathematics onto the architecture
• "LINEAL: an electronic encyclopedia in linear algebra"

... Corporate Social Policy as an Approach to Managing the Workforce: Some Examples from U. S. History, . ... Corporate social policy is one of the most significant subjects studied by business historians. To attract workers and maintain sound businesses some Russian entrepreneurs adopted paternalistic social welfare policies, described in several recently published works. ...

Еще в разделе: (Показать все результаты (>65) - hist.msu.ru/ )

• Project "The Labour Relations Evolution in Russian Industries"

... Cleo batch system is purposed to control parallel tasks on computer clusters. It controls one or more task queues. tasks sceduling (all MPI implemetations are supported, most other parallel environments are supported too) . ... controllable user limits (max used cpus, task work time, etc.) . ... Any task in main will be queued to daughter queues if there aren't enough free own cpus (not shared with daughters). When daughter queues will get enough cpus for this task, it will be runned in main . ...

36. Symbolic circuit processor

37. Кафедра Исследования Операций

38. Public administration. Web journal

39. Nonlinear Problems of Gydrodynamic Stability Theory

40. Moodle ФИЯР МГУ