CompHEP constructs a list of quantum fields according to the Table of particles described above. Besides of names enumerated in this table CompHEP generates auxiliary fields, for example, the Faddeev-Popov ghosts [ Bjorken&Drell ]. ... The ghost fields do not correspond to physical degrees of freedom, but each of them has some real particle as a prototype. The names of ghost fields are constructed by CompHEP from the prototype particle name followed by a suffix which specify a type of ghost. ...

Еще в разделе: (Показать все результаты (>1584) - theory.sinp.msu.ru/ )

• Phase space functions
• Summation of ghost diagrams in CompHEP
• Example: Summation of diagrams and symbolic integration by means of the Reduce

... Re: may someone tell me how to write the following sentences in russia [ re: CAnEP ] . ... Re: may someone tell me how to write the following sentences in russia [ re: nu3geTC ] . ... Re: may someone tell me how to write the following sentences in russia [ re: DizzyDen ] . ... Re: may someone tell me how to write the following sentences in russia [ re: Spring ] . ...

Еще в разделе: (Показать все результаты (>5363) - www.fds-net.ru/ )

Astronomy Picture of the Day . ... 21.10.1999 . ... Credit Copyright: Louis Strous ( LMSAL ), SOHO - MDI Consortium, ESA , NASA Explanation: The Sun rotates on its axis about once every 27 days. ... Just follow the sunspots . ... It shows the Sun's visible surface for most days of August 1999 so that the same sunspots appear many times as the solar rotation carries them across the face of the Sun . ... October 1999 . ... 1999 2000 . ... Publications with keywords: Sun - solar rotation - sunspot . ...

Еще в разделе: (Показать все результаты (>7196) - www.astronet.ru/ )

• Астронет > Follow The Spots
• Астронет > Universe
• October Mars

Network Working Group D. Eastlake Request for Comments: 2606 A. Panitz BCP: 32 June 1999 Category: Best Current Practice Reserved Top Level DNS Names Status of this Memo This document specifies an Internet Best Current Practices for the Internet Community, and requests discussion and suggestions for improvements. ... Abstract To reduce the likelihood of conflict and confusion, a few top level domain names are reserved for use in private testing, as examples in documentation, and the like. ...

Еще в разделе: (Показать все результаты (>22589) - mirror.msu.net/ )

• http://mirror.msu.net/pub/gentoo-portage/www-apps/webdavcgi/files/apache-webdavcgi-0.8-example.conf
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc2606.txt.pdf
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc811.txt

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

Geometrical core (core) is a maximal set of alignment positions such that C atoms in these positions are disposed similarly in ALL input protein chains. ... Minimal core size (#aa's) . ... Alternative core new atoms (%) . ... Geometrical core is a maximal set of alignment positions such that C atoms in these positions are disposed similarly in ALL input protein chain. ... Each input sequences is aligned to the corresponding sequence obtained from the ATOM section of the protein chain in the PDB file. ...

Еще в разделе: (Показать все результаты (>6983) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Alignment example
• NPG-explorer

... О UNИX . ... ExportDump . ... Example with --page parameter using regular expression . Output . ... Known limitations "moin export dump" is an HTML export utility to create static HTML dumps of wiki content. ... The --page parameter is optional and will dump pages matching the pagename. ... With the parameter, the output is limited by ACL rules to pages that can be read by the username. ... Note the --page , --target-dir , and --username parameters must follow the export dump parameters. ...

Еще в разделе: (Показать все результаты (>265) - uneex.mithril.cs.msu.su/ )

• HelpOnImages - UNИX
• HelpOnMacros/MailTo - UNИX
• HelpOnInstalling/FastCgi - UNИX

extra:main ]] . CompHEP . ... Script for including cuts, kinematics, or regularizations into batch.dat file . Script for CompHep cross-sections energy dependence calculation . ... When you done CompHep calculations for the process under study at one energy, you may easely get cross-sections energy dependence running script cs_energy_dep.pl . ... For every energy point the script modifies results/batch.dat file and runs CompHep script num_batch.pl to calculate given process cross-sections. ...

Еще в разделе: (Показать все результаты (>90) - comphep.sinp.msu.ru/ )

• tutorials [CompHEP]
• news [CompHEP]
• extra:model:main [CompHEP]

... This program was created for correlating chosen regions in the series of fts images. ... Chosen regions' . ... In this section the program counts the integral for each region of the grid for each image. ... As a matter of fact, the integral is total brightness of the region and it is counted by 'int_tabulated' IDL function. ... In addition, the program will show the count of the regions which correlate with the corresponding region (the brighter region means the bigger count) and its contour. ...

Еще в разделе: (Показать все результаты (>165) - lnfm1.sai.msu.ru/ )

• Data bases of Natural Satellites. Documentation. Sources
• Data bases of Natural Satellites. Documentation. Structure

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>27) - mouse.genebee.msu.ru/ )

• ConClus
• Nhunt: program for nucleic acid sequence similarity search
• Nhunt

... Software . Laboratory of Mathematical Methods of Image Processing . ... Available options: -sigma - (mandatory) set blur parameter for the input image , range: 1.0 to 20.0 - power - set warping power , range: 0.0 to 5.0, default value is 1.0 -1d - apply one-dimensional algorithm (faster but lower quality) basicedges - detect basic edges - edges good for artifact analysis -scale - set scale parameter, range: 1.0 to 20.0, default value is 4.0 gaussblur - blur input ... warp.png . ...

Еще в разделе: (Показать все результаты (>97) - imaging.cmc.msu.ru/ )

... 10 import sequence . ... 12 import allpy_data . ... 14 class Project ( object ): . ... 19 * alignment -- dict . ... 27 def __init__ ( self , * args ): . ... 31 Project(sequences, alignment) -> new Project with sequences and . ... 33 Project(fasta_file) -> new Project, read alignment and sequences . ... sequences , self . ... 97 >>> sequences,alignment=project.Project.get_from_fasta(open("test.fasta")) . ... 133 alignment [ sequences [ - 1 ]] = alignment_list . 134 return sequences , alignment . ...

Еще в разделе: (Показать все результаты (>34841) - kodomo.fbb.msu.ru/ )

• allpy: 505ce122068b lib/project.py
• allpy: 208ec59bad5b lib/project.py
• allpy: 80043822a41e docs/Makefile

... NGOs: The Carriers of Globalization? ... Globalization process: transformation of territory and territoriality; . NGOs as players in the transformation of territoriality; . Networks of CABs in Eastern Europe as an example of deterritorialization of social space. Globalization is a process of reshaping social space and individual perception of the world through transforming the notion of territoriality from state-restricted to transnational space. ...

Еще в разделе: (Показать все результаты (>105) - www.prof.msu.ru/ )

... HPF-DVM) . Language specification . ... 5 ALIGN and REALIGN directives . ... Jacobi algorithm PROGRAM JACOBI PARAMETER (K=8, ITMAX=20) REAL A(K,K), B(K,K) *HPF$ DISTRIBUTE A (BLOCK, BLOCK) *HPF$ ALIGN B(I,J) WITH A(I,J) C arrays A and B with block distribution PRINT *, '******** TEST_JACOBI_HPF ********' C nest of two independent loops, iteration (i,j) will be executed C on processor, which is owner of element A(i,j) *HPF$ INDEPENDENT DO 1 J = 1, K *HPF$ INDEPENDENT DO 1 I = 1, K A(I,J) = 0. ...

Еще в разделе: (Показать все результаты (>120) - sp.cs.msu.ru/ )

• Download DVM-system
• DVM-system. Installation guide. Version 3.82
• DVM-system. Installation guide. Version 3.15

. [ Войти ] . Главная -> Фильмы -> Just Follow Law: Wo zai zhen.. Пользователи . Демо . Деньги . Фильмы . Форум . Just Follow Law: Wo zai zheng fu bu men de ri zi . Сингапур 2007 . отметить . Комедия . Драма . Фэнтэзи .

Еще в разделе: (Показать все результаты (>115) - kinfo.ru/ )

• Following the Rabbit-Proof F.. - Фильмы - Kinfo.ru
• Follow the Prophet - Фильмы - Kinfo.ru
• Follow That Camel - Фильмы - Kinfo.ru

... There are two methods of describing plant associations of the lake-shore: visual and analytical. ... We analyzed each lake separately with help of cluster analysis (Manchattan distance, Ward method). ... Besides, cluster analysis only for common plant species was performed. ... All common species on this lake form one multitudinous cluster (fig. 5), except for Comarum palustre and Equisetum fluviatile (the same group of species reveled by cluster analysis for common species from other lakes). ...

Еще в разделе: (Показать все результаты (>151) - herba.msu.ru/ )

• INTERNATIONAL SYMPOSIUM
• Instruction to authors

О лаборатории . ... Лаборатория теоретической биофизики . ... Here we provide some instructions that will allow you to make your own visualization using powerful abilities of PyMol. Below you can find step-by-step instruction of how to visualize partial charges or other atomic information. ... Partial charge? All charges will appear near all atoms! ... Нет комментариев " Visualize partial charges in PyMol " . ... Visualize partial charges in PyMol . ... 2014 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>57) - erg.biophys.msu.ru/ )

• Gaussian Cube files loader ERG Research Group: Лаборатория теоретической
• python ERG Research Group: Лаборатория теоретической биофизики
• Scanning PES ab initio and in MM ERG Research Group: Лаборатория теоретической

... The application methods of complex professional benchmarking are discussed; it is also shown how these methods are used in the rating and engineering design of supercomputers. ... Keywords: rating list benchmarking, complex test benchmarking, data intensive systems, multilevel benchmarking, space-temporal memory reference locality, memory reference delay optimization, memory reference tolerate, delay hiding, run-time systems, multithreaded architecture program emulation . ...

Еще в разделе: (Показать все результаты (>242) - num-meth.srcc.msu.ru/ )

• "Application of the duality principle in inverse problems for parabolic
• "An evolutionary algorithm of feature accumulation for the construction of
• General Information

... I mean the following Theorem If any local eld (x) is irreducible and [ (x), (y )] = B (x - y ), (1) then operator B (x) is multiple of unit operator, that is (x) is an asymptotic eld. ... Our result is most interesting in the case of noncommutative theory, precisely, in the case of space-space noncommutativity, in which time commutes with spatial variables and, as a consequence, one spatial variable, say x3, commutes with others. ... For simplicity we consider the case of neutral scalar elds. ...

Еще в разделе: (Показать все результаты (>155) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/talks/pr_Gamzova.pdf
• http://qfthep.sinp.msu.ru/talks/QFTHEP2011.pdf

... Next: COM-port initialization file format Up: Scanning Probe Microscopy Image Previous: Software Installation Contents Index . File is written in text format and consists from one section. ... A record has following format: <voltage>=<temperature>; . ... Example of temperature initialization file listed below. [temperature] -3.00=27.5; -2.67=28.0; -2.33=29.0; -2.00=31.5; -1.67=33.5; -1.33=36.0; -1.00=37.0; -0.67=39.0; -0.33=42.0; 0.00=42.5; 0.33=45.0; 0.67=47.5; 1.00=49.0; 1.33=50.0; 3.00=60.0; . ...

Еще в разделе: (Показать все результаты (>54) - www.spm.genebee.msu.ru/ )

• Hysteresys calibration file generation
• COM-port initialization file format
• General calibration