... Previous message: [Comphep-common] comphep error . Next message: [Comphep-common] comphep error . ... Would be much helpful for my > study. > thanks > Ijaz > > ________________________________________ > From: Lev Dudko [ dudko at fnal.gov ] > Sent: 21 November 2014 21:26 > To: Ijaz Ahmed > Cc: comphep-common at theory.sinp.msu.ru > Subject: Re: [Comphep-common] comphep error > > Dear Ijaz, > This is pretty old script from community contribution, not from > CompHEP team. ...

Еще в разделе: (Показать все результаты (>978) - theory.sinp.msu.ru/ )

• Lagrangian expressions
• Phase space functions
• Goldstone ghost.

... Data . ... Models . ... Paraboloid model . ... SHIELDOSE is a model for space-shielding radiation dose calculations. ... Next the index of the detector type is specified, for example '1'. ... The next number indicates the nuclear interaction account, for example 1: . ... The next pair of numbers is about solar protons, the min and max energy of solar protons spectrum, default values are 0.1 and 10000 MeV. ... The next number is the number of spectrum points which divides spectrum for integration. ...

Еще в разделе: (Показать все результаты (>15) - smdc.sinp.msu.ru/ )

... About lab . ... Online Journal "Computer graphics and multimedia" (in russian) . ... Contact person: Dmitriy S. Vatolin (dmitriy@graphics.cs.msu.ru) . MSU Graphics & Media Lab (Video Group) . Filter is intended for reconstructing panorama of scene by movie. ... The work of MSU Panorama is based on motion vectors. ... Example of panorama for ''stefan'' movie . full size image . One more example of MSU Panorama for two processing modes. Example of panorama for ''bus'' movie . ...

Еще в разделе: (Показать все результаты (>207) - graphics.cs.msu.ru/ )

• Building panorama image from video | Лаборатория компьютерной графики и
• Removing of blocking effect from video | Graphics and Media Lab
• Removing of blocking effect from video | Лаборатория компьютерной графики и

... About Trac . ... wiki: WikiRestructuredText . ... Trac supports using reStructuredText (RST) as an alternative to wiki markup in any context WikiFormatting is used. ... See тАЛ this example . ... A table: ===== ===== ====== Inputs Output ------------ ------ A B A or B ===== ===== ====== False False False True False True False True True True True True ===== ===== ====== RST TracLinks ------------- See also ticket `#42`:trac:.. _webpage: http://docutils.sourceforge.net/rst.html }}} . ... False . ...

Еще в разделе: (Показать все результаты (>2059) - kodomo.cmm.msu.ru/ )

• example.snake in snakes тАУ Python Battle
• / (log) ? Python Battle
• InterWiki тАУ Tanchiki

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>12) - storage.bioinf.fbb.msu.ru/ )

... Algorithm & . Format requirements . ... SDPsite is a tool for identification of protein active and other functional sites, based on spatial clustering of SDPs (specificity-determining positions, described here ) with CPs (conserved positions). ... Mapping predictied positions onto structure and construction of the best cluster . ... The input data of the algorithm are a multiple protein alignment divided into specificity groups . ... is called statistical significance of the set of k* positions . ...

Еще в разделе: (Показать все результаты (>135) - bioinf.fbb.msu.ru/ )

• SDPsite - Gallery of examples
• Alignment example
• User's guide

Fortran-DVM . ... Language description . ... 2.2 Syntax of FDVM directives . ... 4.2 Distribution of dynamic arrays . ... 6 Remote data specification . ... 6.2 SHADOW type references . ... 6.2.2 Synchronous specification of independent references of SHADOW type for single loop . ... 6.2.5 Asynchronous specification of independent references of SHADOW type . ... 6.3.3 Asynchronous specification of REMOTE type references . ... 6.4.2 Asynchronous specification of REDUCTION type references . ...

Еще в разделе: (Показать все результаты (>117) - sp.cs.msu.ru/ )

• C-DVM language description
• Fortran DVM compiler. Detailed design
• C-DVM language description. Part 1 (1 - 4)

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>12) - tukachev.flogiston.ru/ )

• Category: Новости

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>59) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• TRF_2d. Page 3.

... Software . Laboratory of Mathematical Methods of Image Processing . ... Available options: -sigma - (mandatory) set blur parameter for the input image , range: 1.0 to 20.0 - power - set warping power , range: 0.0 to 5.0, default value is 1.0 -1d - apply one-dimensional algorithm (faster but lower quality) basicedges - detect basic edges - edges good for artifact analysis -scale - set scale parameter, range: 1.0 to 20.0, default value is 4.0 gaussblur - blur input ... warp.png . ...

Еще в разделе: (Показать все результаты (>136) - imaging.cmc.msu.ru/ )

. PQ web form . PQ reduced web form . TALSN GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLQRNHYWKPTINL DKLWSLVPEETREKYVAGNAPSDKAIVLDLLSLGYAKVLGKGRLPEVPIVVKARYVSKEA ERKIKEAGGVIELV .

Еще в разделе: (Показать все результаты (>17) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Geometrical core
• PLANdbAffy: probe-level annotation database for Affymetrix expression

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . Институт проблем экологии и эволюции им. А.Н. Северцова РАН . Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: shall year June best example, essence tax . ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...

Еще в разделе: (Показать все результаты (>2545) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: center China. the example, the
• Экологический Форум - Фундаментальная Экология: on the will example, refine
• Экологический Форум - Фундаментальная Экология: example, IWC such I is States.

Update on angular acceptance Bamberg , 19th September 2011 V. Kulikovskiy, Y. Yakovenko and H. Costantini Status at the Moscow Meeting Fixed some bugs in a geometry and mirrors Added a dynode stack in geometry description Implemented thin layer optical model Bamberg , September 2011 1 OM scans in Erlangen 4 scans x 2 OMs 8 scans that can be used as inputs in GEANT4 simulation to obtain collection efficiency ...

Еще в разделе: (Показать все результаты (>15) - antares.sinp.msu.ru/ )

. An example of a "bad" function with "good" Fourier coefficients / B. Ayanbaev. //Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. 2014. ? 5. P. 51-53 [Moscow Univ. Math. Bulletin. Vol. 69, N 5, 2014.]. An example of "bad" integrable function with "good" Fourier coefficients is constructed in the paper. This result generalizes one theorem of M. I. Dyachenko and S. Yu. Tikhonov. Key words : integrability of functions, Fourier coefficients. ? 5/2014 . Toggle formulas format . (LaTeX / SVG)

Еще в разделе: (Показать все результаты (>118) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika N 6/2012
• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika

Basic MUSCLE 3.6 . ... Alignment title . ... Output format . CLW CLWSTRICT FASTA MSF PHYI PHYS HTML . Output order . ... Tree Picture Options . Picture formats . None Slanted Slanted 2 Rectangular Rectangular 2 Phylogram Unrooted Unrooted 2 . ... Enter / paste here your sequences in FASTA format ( /gi, '\n').replace(/ \s?t;/gi, '>');">paste example ) . ... Alignment example: . ...

Еще в разделе: (Показать все результаты (>154) - www.genebee.msu.ru/ )

• IGLA-3D User Guide
• RNA secondary structure prediction
• Screening pattern or alignmemt against PROTEIN databank

Regularization methods with set extension for solving unstable problems of minimization" . ... Some modifications of regularization methods for solving problems of minimization with inaccurate input data are proposed on the basis of the approach of set extension. ... This allows us to construct regularized problems from the same class the original problem belongs to. For example, if the original problem is a problem of linear programming, then the regularized problem are those from the same class. ...

Еще в разделе: (Показать все результаты (>298) - num-meth.srcc.msu.ru/ )

• "Application of the duality principle in inverse problems for parabolic
• "The sensitivity storage in problems of hydraulic conductivity identification
• "Bayesian network prediction: algorithm and software implementation"

To install package: 1. tar xozvf fitshdr- >.tar.gz 2. cd fitshdr- >/ 3. cd fitshdr 4./config 5. make 6. make install . As result, binaries, scripts and man-pages will be installed. Default location for executables: /usr/local/bin, for man-pages: /usr/local/man/man1 . To change default locations You have to use --prefix, --bindir options for ./config. For example, to install binaries in ${HOME}/bin, man documentations in ${HOME}/man: ./config --prefix=${HOME} . ...

Еще в разделе: (Показать все результаты (>130) - lnfm1.sai.msu.ru/ )

• Data bases of Natural Satellites. Documentation. Sources
• Data bases of Natural Satellites. Documentation. Structure
• Calibration data

Myotis . Uropatagium venation pattern in bats as diagnostic character (by the example of genus Myotis ) . ... By the example of genus Myotis it was shown that venation pattern on uropatagium of bats in some cases can be used as diagnostic character. Venation features on uropatagium allow easy to separate Daubentonв?Ts bat, eastern water bat, big-footed bat, and pond bat from Brandtв?Ts bat, Siberian bat, whiskered bat, and Ikonnikovв?Ts bat. ... Bats]. ... Bats of the Russian Far East]. ...

Еще в разделе: (Показать все результаты (>524) - zmmu.msu.ru/ )

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>549) - monkey.belozersky.msu.ru/ )

• Example of supporting positions
• SCOP famyli:
• SDPpred

... defmacro defprinter ( name args &body body ) . ... body ) ) . ... defprinter :property ( type name &rest body ) . print-statement-with-body stream body nil "public ~a ~a" type name ) ) . ... defprinter :get ( &rest body ) . print-statement-with-body stream body nil "get" ) ) . ... defprinter :constructor ( name args &rest body ) . ... defprinter :class ( name &rest body ) . print-statement-with-body stream body t "public class ~a" name ) ) . ... defprinter :namespace ( name &rest body ) . ...

Еще в разделе: (Показать все результаты (>2) - depni.sinp.msu.ru/ )

• Visual Energy Level Plot