. PQ web form . PQ reduced web form . TALSN GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLQRNHYWKPTINL DKLWSLVPEETREKYVAGNAPSDKAIVLDLLSLGYAKVLGKGRLPEVPIVVKARYVSKEA ERKIKEAGGVIELV .

Еще в разделе: (Показать все результаты (>16) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Geometrical core
• PLANdbAffy: probe-level annotation database for Affymetrix expression

... О UNИX . ... Examples . ... 1 s = raw_input () 2 repeat = 0 3 for i in xrange ( 1 , len ( s )+ 1 ): 4 found = 1 5 for k in xrange ( 1 , len ( s )/ i ): 6 equal = 0 7 for j in xrange ( i ): 8 if s [ j ]== s [ j + i * k ]: 9 equal += 1 10 if equal == i : 11 found += 1 12 if found * i == len ( s ): 13 if repeat < found : 14 repeat = found 15 print repeat . ... LecturesCMC/PythonIntro2014/06_FilesModulesSystem/Examples (последним исправлял пользователь PavelSutyrin 2014-11-05 12:16:59) . ...

Еще в разделе: (Показать все результаты (>197) - uneex.mithril.cs.msu.su/ )

• Index of /static/GimpDoc_EnRu/images/dialogs/examples
• Index of /static/GimpDoc_EnRu/images/filters/examples
• HelpOnMoinCommand/ExportDump - UNИX

Search: . ... About Trac . ... Previous Revision . Latest Revision . Next Revision . ... Revision Log . View revision: . ... Revision 57:2f62804e21fc , 517 bytes checked in by Daniil Alexeyevsky <me.dendik@тАж>, 5 years ago ( diff ) . Added example snake . ... snake Example . ... Rule 1: chase enemy tail . ... Rule 2: stick to walls . ... Powered by Trac 0.12.5 . ... Visit the Trac open source project at . http://trac.edgewall.org/ ...

Еще в разделе: (Показать все результаты (>1508) - kodomo.cmm.msu.ru/ )

• examples.zip тАУ Cyclyc Cell Automata
• WikiRestructuredText тАУ Tanchiki

... Algorithm & . Format requirements . Contact us . Gallery of examples . SDPsite was applied to 124 families fron the Pfam database . ...

Еще в разделе: (Показать все результаты (>136) - bioinf.fbb.msu.ru/ )

• Alignment example
• User's guide
• Input Formats

Myotis . Uropatagium venation pattern in bats as diagnostic character (by the example of genus Myotis ) . ... By the example of genus Myotis it was shown that venation pattern on uropatagium of bats in some cases can be used as diagnostic character. Venation features on uropatagium allow easy to separate Daubentonв?Ts bat, eastern water bat, big-footed bat, and pond bat from Brandtв?Ts bat, Siberian bat, whiskered bat, and Ikonnikovв?Ts bat. ... Bats]. ... Bats of the Russian Far East]. ...

Еще в разделе: (Показать все результаты (>642) - zmmu.msu.ru/ )

... Corporate Social Policy as an Approach to Managing the Workforce: Some Examples from U. S. History, . ... Corporate social policy is one of the most significant subjects studied by business historians. To attract workers and maintain sound businesses some Russian entrepreneurs adopted paternalistic social welfare policies, described in several recently published works. ...

Еще в разделе: (Показать все результаты (>103) - hist.msu.ru/ )

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . Институт проблем экологии и эволюции им. А.Н. Северцова РАН . Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: Gucci the The example, people really cons . ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...

Еще в разделе: (Показать все результаты (>2043) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: example, IWC such I is States.
• Экологический Форум - Фундаментальная Экология: shall year June best example,
• Экологический Форум - Фундаментальная Экология: on the will example, refine

... Subject : NEW FARM RESOLUTION (From RUSAG conference) . ... This material is from RUSAG conference. ... First, as Deputy Prime Minister Alexander Zaveryukha noted, the government is sticking to its plan to spend the 13.1 trillion rubles already allocated in the farm budget for 1996. ... In addition, the authors of the resolution argue, that with increased government backing, farmers will be able to produce 9 million tons of meat and chicken, 34 million tons of milk, and 32 billion eggs. ...

Еще в разделе: (Показать все результаты (>121) - www.fadr.msu.ru/ )

• М.П.Гурьянова СОВМЕСТНЫЙ ИССЛЕДОВАТЕЛЬСКИЙ ПРОЕКТ АСОПиР
• Jennifer Abel COMMENTS ON PAPERS
• Отклик на статью Никольского (М. Гаранджа)

... Query: E. coli K12 tRNA (valV, selC, asnV, leuT, argZ from EMBL entry U00096 ) . ... BLASTN (both) | ... Nhunt . ... BLASTN (optimal): 3.5 s . BLASTN (default): 0.8 s . ... Nhunt: 7 s The program Nhunt surpass all other tested programs in sensitivity. ... Nhunt BLASTN (optimal): 2.9 s . ... Nhunt: 3.7 s BLASTN with default parameters actually cannot find any significant homologues. ... Nhunt-3: 1.7 s BLASTN with default parameters actually cann't find any significant homologues. ...

Еще в разделе: (Показать все результаты (>14) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• ConClus
• Nhunt

Alignment COG1325 . ... It is supported by 29 positions - that's written on the scheme. ... Such are positions number 5 ( leucine opposite isoleucine , valine and methyonine ), 30 ( glutamic acid opposite arginine , glycine and serine ), 51 ( threonine opposite alanine , phenylalanine and serine ), 55 ( phenylalanine opposite leucine , histidine and tyrosine ), 111 ( phenylalanine opposite isoleucine , leucine and valine ), 123 ( valine opposite isoleucine , ...

Еще в разделе: (Показать все результаты (>54) - monkey.belozersky.msu.ru/ )

• SDP home page
• SCOP famyli:
• SDPpred

. [Назад к основному тексту]

Еще в разделе: (Показать все результаты (>345) - chem.msu.ru/ )

• Entrance Examinations - Preliminary Round
• Entrance Examinations - Main Round

blockmode - filter to block average (x,y,z) data by mode estimation. blockmode [ xyz [ w ] file ( s ) ] -I x _ inc [ m|c ][/ y _ inc [ m|c ]] -R west / east / south / north [ r ] [ -H [ nrec ] ] [ -N ] [ -Q ] [ -V ] [ -W [ io ] ] [ -: ] [ -bi [ s ][ n ] ] [ -bo [ s ] ] blockmode reads arbitrarily located (x,y,z) triples [or optionally weighted quadruples (x,y,z,w)] from standard input [or xyz [ w ] file ( s )] and writes to standard ... If used, GMT default is 1 header record. ...

Еще в разделе: (Показать все результаты (>445) - xray.sai.msu.ru/ )

• http://xray.sai.msu.ru/~ivan/gmt/man/blockmedian.html
• http://xray.sai.msu.ru/~ivan/gmt/man/blockmean.html
• http://xray.sai.msu.ru/~ivan/gmt/man/nearneighbor.html

Online Services | ... Nuclear Wallet Cards" . USA National Nuclear Data Center - NNDC . ... Nuclei Selection: . All nuclei Only even Only odd . ... Decay Type: . decay . ... CDFE Head: Vladimir V. Varlamov . ...

Еще в разделе: (Показать все результаты (>21) - cdfe.sinp.msu.ru/ )

• CDFE => Online Services => Nucleus Ground State Parameters
• CDFE => Online Services => NSR Search Engine
• CDFE provides the major photonuclear databases. Online Services.

... Next: Scan lines averaging Up: Image formation and processing Previous: Averaging data Contents Index . Figure 1.8: Median filtering . ... If we put point's coordinate on horizontal line, and point's value on vertical line, we obtain two-dimensional profile. For filtering point we get values of its neighbors and put them into table. ... Thus if we had a sharp peak in a point, the point's value hit the last cells in the table and does not go to the final image. ... 1.8 ). ...

Еще в разделе: (Показать все результаты (>74) - www.spm.genebee.msu.ru/ )

... Поступление в лабораторию . ... Электронный журнал "Компьютерная графика и мультимедиа" . ... MSU Graphics & Media Lab (Video Group) . The filter is intended for recovering visual quality of video ripped from DVD (for example, when it contains 4 hours of video data), VideoCD or after decompressing by H.261, H.263, H.264, DivX, XviD, etc. The algorithm decreases blocking artifacts, significantly improving visual quality of video. ... Filter for VirtualDub MSU Deblocking (68 KB, ZIP) . ...

Еще в разделе: (Показать все результаты (>189) - graphics.cs.msu.ru/ )

• Removing of blocking effect from video | Graphics and Media Lab
• Removing of brightness flicker in video | Graphics and Media Lab
• Removing of brightness flicker in video | Лаборатория компьютерной графики и

Примеры из книги О.Д.Авраамовой . ... 5_2.WRL Повторное использование объектов (лучше смотреть с отмеченной опцией "wireframe rendering" браузера, поскольку сфера находится внутри куба и обычным образом видна не будет) . 6_1.WRL Эллипсоид вращения (пример использования узла Transform) . ... 8_2.WRL Пример иллюстрирует использование вариабельности разных полей узла Material. ... Для того, чтобы пример работал и на вашем локальном диске, не забудьте скопировать файл 12_3.WRL . ...

Еще в разделе: (Показать все результаты (>81) - www.srcc.msu.ru/ )

... Полная версия этой страницы: Каррент мьюзик . Студенческий форум Физфака МГУ > Общий > ТРЕП > Карренты . ... True andЪ EvilЪ . ... Posted by 195.91.219.66. of WebWarper: see /han Example of using WebWarper: http://www.webwarper.net/ww/~av/forum.dubi...hp?showforum=42 ] . ... Posted by 195.91.219.66. of WebWarper: see /han Example of using WebWarper: http://www.webwarper.net/ww/~av/forum.dubi...dex.php?act=idx ] . ... 8.12.2005, 0:27 . ...

Еще в разделе: (Показать все результаты (>544) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > Ассоциации
• Студенческий форум Физфака МГУ > Current Doing
• Студенческий форум Физфака МГУ > Игра "кошка или собака"

Described below are two methods for preparing input files with basis sets and ECPs which are not currently built in. ... Put basis sets and ECPs in directories (called here def2_svp_BAS and def2_ecp_ECP but you can call them whatever you want) and copy them to the Firefly directory. ... Both methods can also be used for preparing gamess (us) files - the check runs may not terminate properly due to certain keywords, but a useable file called 'input' is normally generated. ...

Еще в разделе: (Показать все результаты (>65) - classic.chem.msu.su/ )

• Potential Energy Surfaces with PC GAMESS/Firefly
• Firefly documentation - state-specific gradients for state-averaged MCSCF and
• How to run Firefly under Linux?

... создается некое подобие 3-х мерного пространства Слова показа и и отображены таким же способом. -- param name =example_object_0 value = pltext step =20 font =Verdana:28,3 value =%АППЛЕТ% link = exline :0 color =#009999 param name =example_object_1 value = pltext step =20 shifts=2,2 font =Verdana:28,3 value =%АППЛЕТ% link = ...

Еще в разделе: (Показать все результаты (>16) - adept.srcc.msu.ru/ )

• http://adept.srcc.msu.ru/adept/java/applet_book/layer/layer4text1.htm
• http://adept.srcc.msu.ru/adept/java/applet_book/cursor/cursor1text1.htm
• http://adept.srcc.msu.ru/adept/java/applet_book/layer/layer1text1.htm

.

Еще в разделе: (Показать все результаты (>166) - lnfm1.sai.msu.ru/ )

• http://lnfm1.sai.msu.ru/maidanak/pictures/arc.html
• http://lnfm1.sai.msu.ru/maidanak/pictures/5_domeazt22.html
• http://lnfm1.sai.msu.ru/maidanak/pictures/4_observer.html