... In the region of ferroelectric phase transition of Rb 2 ZnCl 4 crystals, the relaxation of incommensurate (soliton) structure (IS) transferred abruptly to a nonequilibrium state with uniaxial mechanical stress G has been studied. The evolution of IS was recorded by recording changes in the dielectric constant E along the Y axis. ... As a result the E, t-curves corresponding to different initial states intersect and further they follow again the time logarithmic law. ...

Еще в разделе: (Показать все результаты (>62) - scon155.phys.msu.su/ )

• Kinetics of domain structure in ferroelectric thin films

... A.V. Eliseev . ... V.V. Adushkin, A.V. Vityazev, D.O. Glazachev, G.V. Pechernikova . Exogenous factors in the evolution of the Earth. ... Cosmic rays as a factor of biospheric evolution . ... A.V. Yakushev, N.A. Churilin, V.S. Soina, A.G. Kudinova, E.A. Vorobyova, N.S. Mergelov . ...

Еще в разделе: (Показать все результаты (>57) - comet.sai.msu.ru/ )

• IAC, Evolution of Galaxies, Conference
• Dm. Bizyaev's Publications
• Previous and Proposed

... WORKSHOP "STELLAR ATMOSPHERES" . THE CHEMICAL AND DYNAMIC EVOLUTION OF STARS AND GALAXIES" . ... Chernomorka , Odessa , Ukraine . ... Modeling and interpretation of the stellar spectra of the usual and peculiar stars. Elemental abundances in the stars of different types and populations of the Galaxy. Chemical evolution of the stars and galaxies. ... Andrievsky S.M. (OAO ONU, Odessa, Ukraine) . ... CHEMICAL and DYNAMIC EVOLUTION STARS and GALAXIES" . ... Odessa mailto:astro@paco.odessa.ua . ...

Еще в разделе: (Показать все результаты (>93) - sai.msu.ru/ )

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Re: Пятый чемпионат ГЗ по Pro Evolution Soccer! [ re: classic ] . ... Re: Пятый чемпионат ГЗ по Pro Evolution Soccer! [ re: MOHAX ] . ...

Еще в разделе: (Показать все результаты (>571) - www.snto-msu.net/ )

• Evolution de l'Europe de l'an 1000 à 2005 - Public forum of MSU united
• Pro Evolution Soccer 2008 - Public forum of MSU united student networks
• Третий чемпионат ГЗ по Pro Evolution Soccer - Public forum of MSU united

. Главное меню . Введение . Введение в задачи практикума STEV . Ознакомление . Знакомство с устройством задачи STEV . Расчет моделей . Расчет моделей звезд и эволюционных треков . Задания . Учебные задания . Теория . Краткая теория расчета эволюции звезд . Наблюдения . Сравнение теоретических расчетов с наблюдениями . Литература . Рекомендованная литература .

Еще в разделе: (Показать все результаты (>26) - observ.pereplet.ru/ )

• Справка по STEV
• Обсерватория

. [ Войти ] . Главная -> Фильмы -> Dragonball Evolution . Пользователи . Демо . Деньги . Фильмы . Форум . Dragonball Evolution . Драконий жемчуг: Эволюция . США 2009 . отметить . Приключение . Фантастика . Триллер . Фэнтэзи . Боевик .

Еще в разделе: (Показать все результаты (>62) - kinfo.ru/ )

• X-Men: Evolution - Фильмы - Kinfo.ru
• Epoch II: Evolution - Фильмы - Kinfo.ru
• Underworld: Evolution - Фильмы - Kinfo.ru

. Name . Last Modified . Size . Type . Parent Directory / . - . Directory . ChangeLog . 2016-Apr-03 18:31:17 . 5.7K . application/octet-stream . ChangeLog-2015 . 2015-Nov-09 07:11:44 . 93.6K . application/octet-stream . Manifest . 2016-Apr-03 18:31:17 . 2.6K . application/octet-stream . evolution-3.18.5.1.ebuild . 2016-Mar-07 11:06:56 . 4.1K . text/plain . evolution-3.18.5.2.ebuild . 2016-Apr-03 15:39:49 . 4.1K . text/plain . metadata.xml . 2016-Jan-25 02:06:09 . 0.9K . text/xml . lighttpd/1.4.35

Еще в разделе: (Показать все результаты (>17163) - mirror.msu.net/ )

• Index of /pub/gentoo-portage/gnome-extra/evolution-data-server/
• Index of /pub/gentoo-portage/sec-policy/selinux-evolution/
• Index of /pub/gentoo-portage/dev-python/django-evolution/

The в??developmental conduitв?? of the tribe Microtini (Rodentia, Arvicolinae): Systematic and evolutionary aspects . ... P.104-118 [in Russian, with English summary]. ... Anatomy of the arvicoline radiation (Rodentia): palaeogeographical, palaeoecological history and evolutionary data // Annales Zoologici Fennici. ... Molecular phylogeny of the speciose vole genus Microtus (Arvicolinae, Rodentia) inferred from mitochondrial DNA sequences // Molecular Phylogenetics and Evolution. ...

Еще в разделе: (Показать все результаты (>1543) - zmmu.msu.ru/ )

• Two sympatric phylogroups of the Asian badger Meles leucurus (Carnivora:
• Mammoth calf from Bolshoi Lyakhovskii Island (New Siberian Islands, Arctic
• Postglacial recolonisation of European Russia by the common shrew Sorex araneus

... subject on semigroups of operators and evolution equations: . ... 3 rd   International Workshop-Conference on Evolution Equations, Control Theory and   Biomathematics, Han-sur-Lesse, Belgium(1991); . ... Evolution Equations Conference, Glasgow, UK (July, 1994); . ... Fifth International Conference on Evolution Equations and Their Applications to Technology, Hiroshima, Japan (October, 1996); . ... International Conference on Differential Equations and Dynamical Systems, Suzdal, Russia ( July, 2002); ...

Еще в разделе: (Показать все результаты (>136) - srcc.msu.ru/ )

• Катрич Н.С. The evolution of phylogenetic system and ecology // E-Conference
• T.G.Arshakian, R.Beck, M.Krause, D.Sokoloff Evolution of magnetic fields in
• D.Sokoloff Galaxy formation and evolution by Houjun Mo, Frank van den Bosch and

... Devitrification of glass with the cation ratio, corresponding to the {Bi2.18Sr2CaCu2Ox+0.4Sr1.7Ca1.3Al2O6} composition, was studied. ... Above 600 o C, Bi-2212 and (Sr,Ca)3Al2O6 formed simultaneously, so that at 750 o C, the two-phase composite Bi-2212 - (Sr,Ca)3Al2O6 was obtained that contained grains of the aluminate phase 0.03-0.3 micron in size. ...

Еще в разделе: (Показать все результаты (>558) - chem.msu.ru/ )

• Moscow University Chemistry Bulletin Vol. 47, No. 5, P. 318 (2006)
• Moscow University Chemistry Bulletin Vol. 53, No. 4, P. 278 (2012)
• Moscow University Chemistry Bulletin Vol. 44, No. 1, P. 31 (2003)

... Студенческая Астрономическая обсерватория ГАИШ . ... Структура ГАИШ : Отдел внегалактической астрономии : . ... For those really interested in galaxies, extragalactic astronomy or the aspects of cosmology we study, we can always find an interesting problem to work on. ... To make your work in the Group most effective, it would be useful to study the following courses read by our group members as well as the members of other groups in our and other institures. ... Student information . ...

Еще в разделе: (Показать все результаты (>20) - www.sai.msu.ru/ )

Mailing List . Discussion club . Unresolved problems in the Study of Nature and Evolution of Human Language . ... Our goal is to consider some interesting and still unresolved problems of general theory of Human Language. ... Regularities of Human Language Evolution”. ... Universal, typological and stylistic features of Human Language Evolution; . ... Large Explanatory Dictionary of Russian (SPb: Norint, 1998. - 1536p.): preliminary evoluation of the dictionary (Russian letter "X") . ...

Еще в разделе: (Показать все результаты (>74) - old.philol.msu.ru/ )

• Basic Assumptions about a Sign's Life Cycle for Mathematical Modelling of
• Khmelev D.V.- Disputed Authorship Resolution Using Relative Empirical Entropy

... Для исследования была взята последовательность белка Malk_ecoli . ... Identities = 214/326 (65%), Positives = 257/326 (78%), Gaps = 13/326 (3%) Query 1 LRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGA 60 LR IAGLE ITSGDLFIGE+RMND P++RGVGMVFQSYALYPHL++ +NMSFGLKL+ A Sbjct 46 LRCIAGLEDITSGDLFIGEQRMNDVEPSKRGVGMVFQSYALYPHLNLYDNMSFGLKLSKA 105 Query 61 KKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLD 120 K I +RV+ AE+LQL+HLLDR+PKALSGGQRQRVAIGRTLV++P+VFLLDEPLSNLD ...

Еще в разделе: (Показать все результаты (>474) - kodomo.cmm.msu.ru/ )

• Practice1(evolution)
• evolution
• Gene Evolution Reconstruction

... The Evolution of the Russian Tax System in the 19thcentury, . ... Ezhegodnik (Economic Hystory. ... 2002 , Moscow: ROSSPEN, 2003, p.345-383. ... The article deals with the history of the taxes of the Russian empire in the 19th century. ... Despite of the lag with the European model which consisted in the absence of income taxation, the Russian tax system had provided the budget with monetary resources, that were necessary for the financial stability of the Empire. ...

Еще в разделе: (Показать все результаты (>128) - hist.msu.ru/ )

• Project "The Labour Relations Evolution in Russian Industries"

Title Author Key words The role of globalization in the evolution of welfare state functions Vasiliev V.P liberal state, globalization, multinational corporations, the crisis of the welfare state, the social responsibility of business, supranational bodies and mechanisms management "market failures", mixed economy, economic crises This article describes a set of problems of evolution of the modern state. Tendencies modification of the territorial state in the context of globalization. ...

Еще в разделе: (Показать все результаты (>66) - www.socio.msu.ru/ )

• http://www.socio.msu.ru/vestnik/eng/archive/2014/2/13.pdf
• http://www.socio.msu.ru/vestnik/eng/archive/2014/4/03.pdf
• http://www.socio.msu.ru/vestnik/eng/archive/2014/4/04.pdf

CONTROL OF THE CHAOTIC OSCILLATIONS IN THE EXCITABLE MEDIUM IN ONE HETEROGENOUS CATALYTIC REACTION Kurkina E., Selezneva J. Mendeleev's University of Chemical Technologies of Russia, Miusskaya sq., ... Unpredictable behavior of the chaotic oscillations, ambiguity of ways of the process to end, high opportunity of realization the negative results leave us no choice but to look for the methods of controlling chaos. ... These reactions develop the chaotic behavior in definite conditions. ...

Еще в разделе: (Показать все результаты (>13350) - www.mce.biophys.msu.ru/ )

• http://www.mce.biophys.msu.ru/archive/doc24768/eng.pdf
• http://www.mce.biophys.msu.ru/archive/doc151854/eng.pdf
• http://www.mce.biophys.msu.ru/archive/doc151405/eng.pdf

Russian Interdisciplinary . Temporology Seminar: . ... Journals about time . ... 1 October, Tuesday . ... Physical models of torsion fields, making it possible to describe their action upon living matter, are considered. ... EVOLUTION WITHOUT SELECTION OR SELECTION BEFORE EVOLUTION?" ... The structure equality of energy and time in the action parameter, which is minimized on the trajectories of free uniform motion, inspires one to seek the conditions for their physical interchangeability. ...

Еще в разделе: (Показать все результаты (>533) - chronos.msu.ru/ )

A very important stage in a story of formation of any new science is the shift from discussion of situation which are possible but do not occur in practice due to some reason to recognition of real phenomena of interest. ... We suggest to consider computer viruses as this new specific form of life which is coming in the contact with our form of life. ... Computer life has been created by human being, the role of independent evolution of computer viruses seems to be still negligible. ...

Еще в разделе: (Показать все результаты (>216) - lnfm1.sai.msu.ru/ )

• Division of the Galaxy and Variable Stars
• Публикации Н.А.Соловой

email: azrakhmanov@mail.ru) , " ", , , , , , , , , "Economy and society", theoretical sociology, social philosoph sociology, Economy, society, Domination, Classes, Estates, Manuscript , , Max Weber, y, history of textual study, , . ...

Еще в разделе: (Показать все результаты (>73) - vestnik.socio.msu.ru/ )

• http://www.socio.msu.ru/vestnik/archive/2010/1/04.pdf
• http://www.socio.msu.ru/vestnik/archive/2011/1/11.pdf

RELATIVISTIC KINETICS S. A. SMOLYA NSKY , ! The methods and problems of relativistic kinetic theory , which is implemented to describe the evolution of non-equilibrium systems under extreme conditions, are discussed. Some applications of this theory to nuclear physics of intermediate and high energies are presented. , , . ... Smolyansky S.A., Prozorkevich A.V., Maino G., Mashnik S.G. A Covariant Generalization of the Real-Time Green's Functions Method in the Theory of Kinetic Equations // Ann. ...

Еще в разделе: (Показать все результаты (>188) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/mirrors/1996_02.pdf
• http://nuclphys.sinp.msu.ru/conf/epp10/Filchenkov.pdf
• http://nuclphys.sinp.msu.ru/conf/lpp14/220809/Starinets.pdf